BLASTX nr result
ID: Paeonia22_contig00007567
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00007567 (285 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007214494.1| hypothetical protein PRUPE_ppa019693mg [Prun... 61 1e-07 >ref|XP_007214494.1| hypothetical protein PRUPE_ppa019693mg [Prunus persica] gi|462410359|gb|EMJ15693.1| hypothetical protein PRUPE_ppa019693mg [Prunus persica] Length = 368 Score = 61.2 bits (147), Expect = 1e-07 Identities = 34/72 (47%), Positives = 46/72 (63%), Gaps = 4/72 (5%) Frame = -2 Query: 206 MLKLLPWRRSTYQSLT--PNQKMSLLPRFLCQSVTEDTY--DPPFSPIIKTLNPRISNNK 39 MLKLLPWR S +++LT P + S L RFL S++ED Y DPPFSP+ K P+ NK Sbjct: 1 MLKLLPWRPSPHKTLTLDPAKPFSSLSRFLSHSLSEDQYEDDPPFSPVSKP--PKPKKNK 58 Query: 38 KPERTPDSLSDP 3 + PD+ ++P Sbjct: 59 TQNKDPDTKNEP 70