BLASTX nr result
ID: Paeonia22_contig00006579
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00006579 (247 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU39674.1| hypothetical protein MIMGU_mgv1a015683mg [Mimulus... 82 6e-14 gb|EYU37023.1| hypothetical protein MIMGU_mgv1a015651mg [Mimulus... 82 6e-14 gb|EYU32448.1| hypothetical protein MIMGU_mgv1a019785mg [Mimulus... 82 6e-14 gb|AHN10448.1| HTB2-GUS [Binary vector pFGUS3] 82 6e-14 gb|EXC24908.1| Histone H2B.3 [Morus notabilis] 82 6e-14 sp|O22582.3|H2B_GOSHI RecName: Full=Histone H2B gi|2558962|gb|AA... 82 6e-14 ref|NP_197679.1| histone H2B [Arabidopsis thaliana] gi|75170197... 82 6e-14 ref|XP_003539691.2| PREDICTED: probable histone H2B.1-like isofo... 82 6e-14 ref|XP_003538007.2| PREDICTED: probable histone H2B.1-like isofo... 82 6e-14 ref|XP_006364445.1| PREDICTED: histone H2B-like [Solanum tuberosum] 82 6e-14 ref|XP_006360516.1| PREDICTED: histone H2B.6-like [Solanum tuber... 82 6e-14 ref|XP_006345846.1| PREDICTED: histone H2B-like [Solanum tuberosum] 82 6e-14 ref|XP_007148799.1| hypothetical protein PHAVU_005G015300g [Phas... 82 6e-14 ref|XP_007144308.1| hypothetical protein PHAVU_007G145200g [Phas... 82 6e-14 ref|XP_007144307.1| hypothetical protein PHAVU_007G145100g [Phas... 82 6e-14 ref|XP_007132098.1| hypothetical protein PHAVU_011G066600g [Phas... 82 6e-14 ref|XP_007132097.1| hypothetical protein PHAVU_011G066500g [Phas... 82 6e-14 ref|XP_007132096.1| hypothetical protein PHAVU_011G066400g [Phas... 82 6e-14 ref|XP_007132093.1| hypothetical protein PHAVU_011G066200g [Phas... 82 6e-14 ref|XP_007132092.1| hypothetical protein PHAVU_011G066100g [Phas... 82 6e-14 >gb|EYU39674.1| hypothetical protein MIMGU_mgv1a015683mg [Mimulus guttatus] gi|604335787|gb|EYU39675.1| hypothetical protein MIMGU_mgv1a015697mg [Mimulus guttatus] Length = 149 Score = 82.4 bits (202), Expect = 6e-14 Identities = 40/40 (100%), Positives = 40/40 (100%) Frame = +3 Query: 126 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKL 245 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKL Sbjct: 59 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKL 98 >gb|EYU37023.1| hypothetical protein MIMGU_mgv1a015651mg [Mimulus guttatus] Length = 150 Score = 82.4 bits (202), Expect = 6e-14 Identities = 40/40 (100%), Positives = 40/40 (100%) Frame = +3 Query: 126 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKL 245 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKL Sbjct: 60 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKL 99 >gb|EYU32448.1| hypothetical protein MIMGU_mgv1a019785mg [Mimulus guttatus] Length = 138 Score = 82.4 bits (202), Expect = 6e-14 Identities = 40/40 (100%), Positives = 40/40 (100%) Frame = +3 Query: 126 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKL 245 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKL Sbjct: 48 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKL 87 >gb|AHN10448.1| HTB2-GUS [Binary vector pFGUS3] Length = 762 Score = 82.4 bits (202), Expect = 6e-14 Identities = 40/40 (100%), Positives = 40/40 (100%) Frame = +3 Query: 126 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKL 245 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKL Sbjct: 55 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKL 94 >gb|EXC24908.1| Histone H2B.3 [Morus notabilis] Length = 146 Score = 82.4 bits (202), Expect = 6e-14 Identities = 40/40 (100%), Positives = 40/40 (100%) Frame = +3 Query: 126 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKL 245 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKL Sbjct: 56 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKL 95 >sp|O22582.3|H2B_GOSHI RecName: Full=Histone H2B gi|2558962|gb|AAB97163.1| histone H2B1 [Gossypium hirsutum] Length = 147 Score = 82.4 bits (202), Expect = 6e-14 Identities = 40/40 (100%), Positives = 40/40 (100%) Frame = +3 Query: 126 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKL 245 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKL Sbjct: 57 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKL 96 >ref|NP_197679.1| histone H2B [Arabidopsis thaliana] gi|75170197|sp|Q9FFC0.3|H2B10_ARATH RecName: Full=Histone H2B.10; AltName: Full=HTB2 gi|10177235|dbj|BAB10609.1| histone H2B like protein [Arabidopsis thaliana] gi|98960883|gb|ABF58925.1| At5g22880 [Arabidopsis thaliana] gi|332005710|gb|AED93093.1| histone H2B [Arabidopsis thaliana] Length = 145 Score = 82.4 bits (202), Expect = 6e-14 Identities = 40/40 (100%), Positives = 40/40 (100%) Frame = +3 Query: 126 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKL 245 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKL Sbjct: 55 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKL 94 >ref|XP_003539691.2| PREDICTED: probable histone H2B.1-like isoform 1 [Glycine max] Length = 292 Score = 82.4 bits (202), Expect = 6e-14 Identities = 40/40 (100%), Positives = 40/40 (100%) Frame = +3 Query: 126 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKL 245 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKL Sbjct: 59 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKL 98 Score = 82.4 bits (202), Expect = 6e-14 Identities = 40/40 (100%), Positives = 40/40 (100%) Frame = +3 Query: 126 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKL 245 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKL Sbjct: 202 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKL 241 >ref|XP_003538007.2| PREDICTED: probable histone H2B.1-like isoform 1 [Glycine max] Length = 290 Score = 82.4 bits (202), Expect = 6e-14 Identities = 40/40 (100%), Positives = 40/40 (100%) Frame = +3 Query: 126 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKL 245 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKL Sbjct: 58 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKL 97 Score = 82.4 bits (202), Expect = 6e-14 Identities = 40/40 (100%), Positives = 40/40 (100%) Frame = +3 Query: 126 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKL 245 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKL Sbjct: 200 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKL 239 >ref|XP_006364445.1| PREDICTED: histone H2B-like [Solanum tuberosum] Length = 141 Score = 82.4 bits (202), Expect = 6e-14 Identities = 40/40 (100%), Positives = 40/40 (100%) Frame = +3 Query: 126 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKL 245 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKL Sbjct: 51 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKL 90 >ref|XP_006360516.1| PREDICTED: histone H2B.6-like [Solanum tuberosum] Length = 280 Score = 82.4 bits (202), Expect = 6e-14 Identities = 40/40 (100%), Positives = 40/40 (100%) Frame = +3 Query: 126 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKL 245 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKL Sbjct: 52 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKL 91 Score = 82.4 bits (202), Expect = 6e-14 Identities = 40/40 (100%), Positives = 40/40 (100%) Frame = +3 Query: 126 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKL 245 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKL Sbjct: 190 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKL 229 >ref|XP_006345846.1| PREDICTED: histone H2B-like [Solanum tuberosum] Length = 147 Score = 82.4 bits (202), Expect = 6e-14 Identities = 40/40 (100%), Positives = 40/40 (100%) Frame = +3 Query: 126 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKL 245 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKL Sbjct: 57 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKL 96 >ref|XP_007148799.1| hypothetical protein PHAVU_005G015300g [Phaseolus vulgaris] gi|561022063|gb|ESW20793.1| hypothetical protein PHAVU_005G015300g [Phaseolus vulgaris] Length = 147 Score = 82.4 bits (202), Expect = 6e-14 Identities = 40/40 (100%), Positives = 40/40 (100%) Frame = +3 Query: 126 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKL 245 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKL Sbjct: 57 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKL 96 >ref|XP_007144308.1| hypothetical protein PHAVU_007G145200g [Phaseolus vulgaris] gi|561017498|gb|ESW16302.1| hypothetical protein PHAVU_007G145200g [Phaseolus vulgaris] Length = 136 Score = 82.4 bits (202), Expect = 6e-14 Identities = 40/40 (100%), Positives = 40/40 (100%) Frame = +3 Query: 126 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKL 245 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKL Sbjct: 46 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKL 85 >ref|XP_007144307.1| hypothetical protein PHAVU_007G145100g [Phaseolus vulgaris] gi|561017497|gb|ESW16301.1| hypothetical protein PHAVU_007G145100g [Phaseolus vulgaris] Length = 139 Score = 82.4 bits (202), Expect = 6e-14 Identities = 40/40 (100%), Positives = 40/40 (100%) Frame = +3 Query: 126 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKL 245 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKL Sbjct: 49 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKL 88 >ref|XP_007132098.1| hypothetical protein PHAVU_011G066600g [Phaseolus vulgaris] gi|561005098|gb|ESW04092.1| hypothetical protein PHAVU_011G066600g [Phaseolus vulgaris] Length = 147 Score = 82.4 bits (202), Expect = 6e-14 Identities = 40/40 (100%), Positives = 40/40 (100%) Frame = +3 Query: 126 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKL 245 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKL Sbjct: 57 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKL 96 >ref|XP_007132097.1| hypothetical protein PHAVU_011G066500g [Phaseolus vulgaris] gi|561005097|gb|ESW04091.1| hypothetical protein PHAVU_011G066500g [Phaseolus vulgaris] Length = 147 Score = 82.4 bits (202), Expect = 6e-14 Identities = 40/40 (100%), Positives = 40/40 (100%) Frame = +3 Query: 126 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKL 245 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKL Sbjct: 57 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKL 96 >ref|XP_007132096.1| hypothetical protein PHAVU_011G066400g [Phaseolus vulgaris] gi|561005096|gb|ESW04090.1| hypothetical protein PHAVU_011G066400g [Phaseolus vulgaris] Length = 147 Score = 82.4 bits (202), Expect = 6e-14 Identities = 40/40 (100%), Positives = 40/40 (100%) Frame = +3 Query: 126 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKL 245 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKL Sbjct: 57 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKL 96 >ref|XP_007132093.1| hypothetical protein PHAVU_011G066200g [Phaseolus vulgaris] gi|561005093|gb|ESW04087.1| hypothetical protein PHAVU_011G066200g [Phaseolus vulgaris] Length = 147 Score = 82.4 bits (202), Expect = 6e-14 Identities = 40/40 (100%), Positives = 40/40 (100%) Frame = +3 Query: 126 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKL 245 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKL Sbjct: 57 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKL 96 >ref|XP_007132092.1| hypothetical protein PHAVU_011G066100g [Phaseolus vulgaris] gi|561005092|gb|ESW04086.1| hypothetical protein PHAVU_011G066100g [Phaseolus vulgaris] Length = 147 Score = 82.4 bits (202), Expect = 6e-14 Identities = 40/40 (100%), Positives = 40/40 (100%) Frame = +3 Query: 126 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKL 245 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKL Sbjct: 57 VETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKL 96