BLASTX nr result
ID: Paeonia22_contig00006489
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00006489 (2285 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU39709.1| hypothetical protein MIMGU_mgv1a010795mg [Mimulus... 62 9e-07 dbj|BAC65421.1| isopentenyl-diphosphate delta-isomerase [Periplo... 62 9e-07 ref|NP_001059919.1| Os07g0546000 [Oryza sativa Japonica Group] g... 62 9e-07 dbj|BAB16690.2| putative IPP isomerase [Eucommia ulmoides] 62 9e-07 dbj|BAB39471.1| putative IPP isomerase 2 [Sonchus oleraceus] 62 9e-07 emb|CAA57947.1| isopentenyl pyrophosphate isomerase [Clarkia bre... 62 9e-07 ref|XP_004957946.1| PREDICTED: isopentenyl-diphosphate Delta-iso... 62 9e-07 ref|XP_004492840.1| PREDICTED: isopentenyl-diphosphate Delta-iso... 62 9e-07 gb|AGJ03660.1| putative isopentenyl pyrophosphate isomerase [Euc... 62 9e-07 gb|ABA01560.1| isopentenyl pyrophosphate isomerase [Bupleurum fa... 62 9e-07 sp|O48964.1|IDI1_CAMAC RecName: Full=Isopentenyl-diphosphate Del... 62 9e-07 sp|Q39472.2|IDI1_CLABR RecName: Full=Isopentenyl-diphosphate Del... 62 9e-07 gb|ADO87008.1| isopentyl diphosphate isomerase [Santalum album] 62 9e-07 dbj|BAI47570.1| isopentenyl diphosphate isomerase [Ipomoea sp. K... 62 9e-07 gb|ACU56979.1| isopentenyl diphosphate isomerase [Ginkgo biloba] 62 9e-07 ref|XP_002460827.1| hypothetical protein SORBIDRAFT_02g035700 [S... 62 9e-07 gb|ABY90138.1| isopentenyl pyrophosphate isomerase [Bupleurum ch... 62 9e-07 ref|NP_001234853.1| isopentenyl diphosphate isomerase [Solanum l... 62 9e-07 gb|ABR26078.1| isopentenyl pyrophosphate: dimethyllallyl pyropho... 62 9e-07 gb|EAZ04242.1| hypothetical protein OsI_26387 [Oryza sativa Indi... 62 9e-07 >gb|EYU39709.1| hypothetical protein MIMGU_mgv1a010795mg [Mimulus guttatus] Length = 301 Score = 62.4 bits (150), Expect = 9e-07 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 1213 HLMEKIESENLLHRAFSVFLFNSKYELLLQ 1302 HLMEKIESENLLHRAFSVFLFNSKYELLLQ Sbjct: 108 HLMEKIESENLLHRAFSVFLFNSKYELLLQ 137 >dbj|BAC65421.1| isopentenyl-diphosphate delta-isomerase [Periploca sepium] Length = 235 Score = 62.4 bits (150), Expect = 9e-07 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 1213 HLMEKIESENLLHRAFSVFLFNSKYELLLQ 1302 HLMEKIESENLLHRAFSVFLFNSKYELLLQ Sbjct: 42 HLMEKIESENLLHRAFSVFLFNSKYELLLQ 71 >ref|NP_001059919.1| Os07g0546000 [Oryza sativa Japonica Group] gi|27260946|dbj|BAC45064.1| putative isopentenyl pyrophosphate:dimethyllallyl pyrophosphate isomerase [Oryza sativa Japonica Group] gi|50509235|dbj|BAD30511.1| putative isopentenyl pyrophosphate:dimethyllallyl pyrophosphate isomerase [Oryza sativa Japonica Group] gi|113611455|dbj|BAF21833.1| Os07g0546000 [Oryza sativa Japonica Group] gi|215686864|dbj|BAG89714.1| unnamed protein product [Oryza sativa Japonica Group] gi|215692700|dbj|BAG88120.1| unnamed protein product [Oryza sativa Japonica Group] Length = 238 Score = 62.4 bits (150), Expect = 9e-07 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 1213 HLMEKIESENLLHRAFSVFLFNSKYELLLQ 1302 HLMEKIESENLLHRAFSVFLFNSKYELLLQ Sbjct: 45 HLMEKIESENLLHRAFSVFLFNSKYELLLQ 74 >dbj|BAB16690.2| putative IPP isomerase [Eucommia ulmoides] Length = 224 Score = 62.4 bits (150), Expect = 9e-07 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 1213 HLMEKIESENLLHRAFSVFLFNSKYELLLQ 1302 HLMEKIESENLLHRAFSVFLFNSKYELLLQ Sbjct: 25 HLMEKIESENLLHRAFSVFLFNSKYELLLQ 54 >dbj|BAB39471.1| putative IPP isomerase 2 [Sonchus oleraceus] Length = 120 Score = 62.4 bits (150), Expect = 9e-07 Identities = 31/34 (91%), Positives = 31/34 (91%) Frame = +1 Query: 1201 KSAGHLMEKIESENLLHRAFSVFLFNSKYELLLQ 1302 KS HLMEKIE ENLLHRAFSVFLFNSKYELLLQ Sbjct: 11 KSNCHLMEKIEKENLLHRAFSVFLFNSKYELLLQ 44 >emb|CAA57947.1| isopentenyl pyrophosphate isomerase [Clarkia breweri] Length = 290 Score = 62.4 bits (150), Expect = 9e-07 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 1213 HLMEKIESENLLHRAFSVFLFNSKYELLLQ 1302 HLMEKIESENLLHRAFSVFLFNSKYELLLQ Sbjct: 98 HLMEKIESENLLHRAFSVFLFNSKYELLLQ 127 >ref|XP_004957946.1| PREDICTED: isopentenyl-diphosphate Delta-isomerase I, chloroplastic-like [Setaria italica] Length = 334 Score = 62.4 bits (150), Expect = 9e-07 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 1213 HLMEKIESENLLHRAFSVFLFNSKYELLLQ 1302 HLMEKIESENLLHRAFSVFLFNSKYELLLQ Sbjct: 140 HLMEKIESENLLHRAFSVFLFNSKYELLLQ 169 >ref|XP_004492840.1| PREDICTED: isopentenyl-diphosphate Delta-isomerase I-like [Cicer arietinum] Length = 296 Score = 62.4 bits (150), Expect = 9e-07 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 1213 HLMEKIESENLLHRAFSVFLFNSKYELLLQ 1302 HLMEKIESENLLHRAFSVFLFNSKYELLLQ Sbjct: 103 HLMEKIESENLLHRAFSVFLFNSKYELLLQ 132 >gb|AGJ03660.1| putative isopentenyl pyrophosphate isomerase [Eucommia ulmoides] Length = 242 Score = 62.4 bits (150), Expect = 9e-07 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 1213 HLMEKIESENLLHRAFSVFLFNSKYELLLQ 1302 HLMEKIESENLLHRAFSVFLFNSKYELLLQ Sbjct: 43 HLMEKIESENLLHRAFSVFLFNSKYELLLQ 72 >gb|ABA01560.1| isopentenyl pyrophosphate isomerase [Bupleurum falcatum] Length = 176 Score = 62.4 bits (150), Expect = 9e-07 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 1213 HLMEKIESENLLHRAFSVFLFNSKYELLLQ 1302 HLMEKIESENLLHRAFSVFLFNSKYELLLQ Sbjct: 4 HLMEKIESENLLHRAFSVFLFNSKYELLLQ 33 >sp|O48964.1|IDI1_CAMAC RecName: Full=Isopentenyl-diphosphate Delta-isomerase I; AltName: Full=Isopentenyl pyrophosphate isomerase I; Short=IPP isomerase I gi|2736286|gb|AAB94132.1| isopentenyl diphosphate isomerase I [Camptotheca acuminata] Length = 235 Score = 62.4 bits (150), Expect = 9e-07 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 1213 HLMEKIESENLLHRAFSVFLFNSKYELLLQ 1302 HLMEKIESENLLHRAFSVFLFNSKYELLLQ Sbjct: 42 HLMEKIESENLLHRAFSVFLFNSKYELLLQ 71 >sp|Q39472.2|IDI1_CLABR RecName: Full=Isopentenyl-diphosphate Delta-isomerase I; AltName: Full=Isopentenyl pyrophosphate isomerase I; Short=IPP isomerase I Length = 287 Score = 62.4 bits (150), Expect = 9e-07 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 1213 HLMEKIESENLLHRAFSVFLFNSKYELLLQ 1302 HLMEKIESENLLHRAFSVFLFNSKYELLLQ Sbjct: 95 HLMEKIESENLLHRAFSVFLFNSKYELLLQ 124 >gb|ADO87008.1| isopentyl diphosphate isomerase [Santalum album] Length = 301 Score = 62.4 bits (150), Expect = 9e-07 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 1213 HLMEKIESENLLHRAFSVFLFNSKYELLLQ 1302 HLMEKIESENLLHRAFSVFLFNSKYELLLQ Sbjct: 108 HLMEKIESENLLHRAFSVFLFNSKYELLLQ 137 >dbj|BAI47570.1| isopentenyl diphosphate isomerase [Ipomoea sp. Kenyan] Length = 235 Score = 62.4 bits (150), Expect = 9e-07 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 1213 HLMEKIESENLLHRAFSVFLFNSKYELLLQ 1302 HLMEKIESENLLHRAFSVFLFNSKYELLLQ Sbjct: 42 HLMEKIESENLLHRAFSVFLFNSKYELLLQ 71 >gb|ACU56979.1| isopentenyl diphosphate isomerase [Ginkgo biloba] Length = 317 Score = 62.4 bits (150), Expect = 9e-07 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 1213 HLMEKIESENLLHRAFSVFLFNSKYELLLQ 1302 HLMEKIESENLLHRAFSVFLFNSKYELLLQ Sbjct: 124 HLMEKIESENLLHRAFSVFLFNSKYELLLQ 153 >ref|XP_002460827.1| hypothetical protein SORBIDRAFT_02g035700 [Sorghum bicolor] gi|241924204|gb|EER97348.1| hypothetical protein SORBIDRAFT_02g035700 [Sorghum bicolor] Length = 237 Score = 62.4 bits (150), Expect = 9e-07 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 1213 HLMEKIESENLLHRAFSVFLFNSKYELLLQ 1302 HLMEKIESENLLHRAFSVFLFNSKYELLLQ Sbjct: 43 HLMEKIESENLLHRAFSVFLFNSKYELLLQ 72 >gb|ABY90138.1| isopentenyl pyrophosphate isomerase [Bupleurum chinense] Length = 177 Score = 62.4 bits (150), Expect = 9e-07 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 1213 HLMEKIESENLLHRAFSVFLFNSKYELLLQ 1302 HLMEKIESENLLHRAFSVFLFNSKYELLLQ Sbjct: 5 HLMEKIESENLLHRAFSVFLFNSKYELLLQ 34 >ref|NP_001234853.1| isopentenyl diphosphate isomerase [Solanum lycopersicum] gi|160966279|gb|ABX55779.1| isopentenyl diphosphate isomerase [Solanum lycopersicum] Length = 235 Score = 62.4 bits (150), Expect = 9e-07 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 1213 HLMEKIESENLLHRAFSVFLFNSKYELLLQ 1302 HLMEKIESENLLHRAFSVFLFNSKYELLLQ Sbjct: 42 HLMEKIESENLLHRAFSVFLFNSKYELLLQ 71 >gb|ABR26078.1| isopentenyl pyrophosphate: dimethyllallyl pyrophosphate isomerase [Oryza sativa Indica Group] Length = 201 Score = 62.4 bits (150), Expect = 9e-07 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 1213 HLMEKIESENLLHRAFSVFLFNSKYELLLQ 1302 HLMEKIESENLLHRAFSVFLFNSKYELLLQ Sbjct: 8 HLMEKIESENLLHRAFSVFLFNSKYELLLQ 37 >gb|EAZ04242.1| hypothetical protein OsI_26387 [Oryza sativa Indica Group] Length = 722 Score = 62.4 bits (150), Expect = 9e-07 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +1 Query: 1213 HLMEKIESENLLHRAFSVFLFNSKYELLLQ 1302 HLMEKIESENLLHRAFSVFLFNSKYELLLQ Sbjct: 45 HLMEKIESENLLHRAFSVFLFNSKYELLLQ 74