BLASTX nr result
ID: Paeonia22_contig00006349
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00006349 (512 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002528741.1| Cell division protein ftsZ, putative [Ricinu... 56 6e-06 >ref|XP_002528741.1| Cell division protein ftsZ, putative [Ricinus communis] gi|223531835|gb|EEF33653.1| Cell division protein ftsZ, putative [Ricinus communis] Length = 485 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/47 (55%), Positives = 34/47 (72%) Frame = +2 Query: 113 MASHISSCFTQCDARNPMGHLTVLGRRVSVENHAGKLSSMNMFDDKN 253 MA+ +S T D RNPMG LTVLG R++VENH G++ S+ + DDKN Sbjct: 1 MAACVSPYCTPSDTRNPMGMLTVLGGRLAVENHLGRVGSLKLSDDKN 47