BLASTX nr result
ID: Paeonia22_contig00003962
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00003962 (1762 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAC25423.1| calcium-dependent protein kinase [Nicotiana tabacum] 97 2e-17 gb|ACY78680.1| calcium-dependent protein kinase 1 [Panax ginseng] 97 2e-17 gb|ADZ52811.1| calcium-dependent protein kinase 3 [Solanum tuber... 96 5e-17 ref|NP_001234806.1| calcium-dependent protein kinase [Solanum ly... 96 5e-17 ref|XP_002518484.1| calcium-dependent protein kinase, putative [... 96 7e-17 gb|EXB50311.1| Calcium-dependent protein kinase 9 [Morus notabilis] 95 9e-17 ref|NP_001275456.1| calcium-dependent protein kinase 3 [Solanum ... 94 2e-16 ref|XP_004294385.1| PREDICTED: calcium-dependent protein kinase ... 94 3e-16 ref|XP_003519577.1| PREDICTED: calcium-dependent protein kinase ... 94 3e-16 gb|EYU33891.1| hypothetical protein MIMGU_mgv1a004201mg [Mimulus... 93 3e-16 ref|XP_006475136.1| PREDICTED: calcium-dependent protein kinase ... 93 3e-16 ref|XP_006389625.1| hypothetical protein POPTR_0021s00750g [Popu... 93 3e-16 ref|XP_006283446.1| hypothetical protein CARUB_v10004493mg [Caps... 93 4e-16 gb|AGG35970.1| calcium-dependent protein kinase 21 [Brassica napus] 92 6e-16 ref|XP_006396672.1| hypothetical protein EUTSA_v10028567mg [Eutr... 92 6e-16 gb|EPS59225.1| calcium-dependent protein kinase 1, partial [Genl... 92 6e-16 ref|XP_006289661.1| hypothetical protein CARUB_v10003219mg [Caps... 92 6e-16 ref|XP_002874811.1| calcium-dependent protein kinase 21 [Arabido... 92 6e-16 ref|XP_006452371.1| hypothetical protein CICLE_v10007983mg [Citr... 91 1e-15 ref|XP_004134759.1| PREDICTED: calcium-dependent protein kinase ... 91 1e-15 >gb|AAC25423.1| calcium-dependent protein kinase [Nicotiana tabacum] Length = 540 Score = 97.1 bits (240), Expect = 2e-17 Identities = 46/50 (92%), Positives = 49/50 (98%) Frame = -1 Query: 151 FITRDELEAAMKEYGMGDEATIKEIISEVDTYNDGRINYDEFCAMMRSGT 2 FITRDELE+AMKEYGMGDEATIKEII+EVDT NDGRINY+EFCAMMRSGT Sbjct: 484 FITRDELESAMKEYGMGDEATIKEIIAEVDTDNDGRINYEEFCAMMRSGT 533 >gb|ACY78680.1| calcium-dependent protein kinase 1 [Panax ginseng] Length = 549 Score = 97.1 bits (240), Expect = 2e-17 Identities = 47/53 (88%), Positives = 49/53 (92%) Frame = -1 Query: 160 SCRFITRDELEAAMKEYGMGDEATIKEIISEVDTYNDGRINYDEFCAMMRSGT 2 S FITRDELE+AMKEYGMGDEATIKEIISEVDT NDGRINY+EFC MMRSGT Sbjct: 489 SSGFITRDELESAMKEYGMGDEATIKEIISEVDTDNDGRINYEEFCTMMRSGT 541 >gb|ADZ52811.1| calcium-dependent protein kinase 3 [Solanum tuberosum] Length = 554 Score = 95.9 bits (237), Expect = 5e-17 Identities = 46/50 (92%), Positives = 48/50 (96%) Frame = -1 Query: 151 FITRDELEAAMKEYGMGDEATIKEIISEVDTYNDGRINYDEFCAMMRSGT 2 FITRDELE AMKEYGMGDEATIKEII+EVDT NDGRINY+EFCAMMRSGT Sbjct: 497 FITRDELENAMKEYGMGDEATIKEIITEVDTDNDGRINYEEFCAMMRSGT 546 >ref|NP_001234806.1| calcium-dependent protein kinase [Solanum lycopersicum] gi|19171502|emb|CAC87494.1| calcium-dependent protein kinase [Solanum lycopersicum] Length = 553 Score = 95.9 bits (237), Expect = 5e-17 Identities = 46/50 (92%), Positives = 48/50 (96%) Frame = -1 Query: 151 FITRDELEAAMKEYGMGDEATIKEIISEVDTYNDGRINYDEFCAMMRSGT 2 FITRDELE AMKEYGMGDEATIKEII+EVDT NDGRINY+EFCAMMRSGT Sbjct: 496 FITRDELENAMKEYGMGDEATIKEIIAEVDTDNDGRINYEEFCAMMRSGT 545 >ref|XP_002518484.1| calcium-dependent protein kinase, putative [Ricinus communis] gi|223542329|gb|EEF43871.1| calcium-dependent protein kinase, putative [Ricinus communis] Length = 551 Score = 95.5 bits (236), Expect = 7e-17 Identities = 46/52 (88%), Positives = 49/52 (94%) Frame = -1 Query: 160 SCRFITRDELEAAMKEYGMGDEATIKEIISEVDTYNDGRINYDEFCAMMRSG 5 S +ITRDELE+AMKEYGMGDEATIKEIISEVDT NDGRINY+EFCAMMRSG Sbjct: 492 SSGYITRDELESAMKEYGMGDEATIKEIISEVDTDNDGRINYEEFCAMMRSG 543 >gb|EXB50311.1| Calcium-dependent protein kinase 9 [Morus notabilis] Length = 548 Score = 95.1 bits (235), Expect = 9e-17 Identities = 46/53 (86%), Positives = 48/53 (90%) Frame = -1 Query: 160 SCRFITRDELEAAMKEYGMGDEATIKEIISEVDTYNDGRINYDEFCAMMRSGT 2 S FITRDELE AMK+YGMGDEATI+EIISEVDT NDGRINY EFCAMMRSGT Sbjct: 489 SSGFITRDELETAMKDYGMGDEATIREIISEVDTDNDGRINYSEFCAMMRSGT 541 >ref|NP_001275456.1| calcium-dependent protein kinase 3 [Solanum tuberosum] gi|297342355|gb|AAQ08324.2| calcium-dependent protein kinase 3 [Solanum tuberosum] Length = 558 Score = 94.4 bits (233), Expect = 2e-16 Identities = 45/50 (90%), Positives = 47/50 (94%) Frame = -1 Query: 151 FITRDELEAAMKEYGMGDEATIKEIISEVDTYNDGRINYDEFCAMMRSGT 2 FITRDELE AMKEYGMGDE TIKEII+EVDT NDGRINY+EFCAMMRSGT Sbjct: 501 FITRDELENAMKEYGMGDETTIKEIIAEVDTDNDGRINYEEFCAMMRSGT 550 >ref|XP_004294385.1| PREDICTED: calcium-dependent protein kinase 9-like [Fragaria vesca subsp. vesca] Length = 541 Score = 93.6 bits (231), Expect = 3e-16 Identities = 44/50 (88%), Positives = 47/50 (94%) Frame = -1 Query: 151 FITRDELEAAMKEYGMGDEATIKEIISEVDTYNDGRINYDEFCAMMRSGT 2 FITRDELE AMKEYGMGDEATI++IISEVDT NDGRINY+EFC MMRSGT Sbjct: 485 FITRDELEKAMKEYGMGDEATIRDIISEVDTDNDGRINYEEFCTMMRSGT 534 >ref|XP_003519577.1| PREDICTED: calcium-dependent protein kinase 9-like isoform 1 [Glycine max] Length = 528 Score = 93.6 bits (231), Expect = 3e-16 Identities = 44/50 (88%), Positives = 47/50 (94%) Frame = -1 Query: 151 FITRDELEAAMKEYGMGDEATIKEIISEVDTYNDGRINYDEFCAMMRSGT 2 +ITRDELE AMKEYGMG+EATI+EIISEVDT NDGRINYDEFC MMRSGT Sbjct: 472 YITRDELETAMKEYGMGNEATIREIISEVDTDNDGRINYDEFCTMMRSGT 521 >gb|EYU33891.1| hypothetical protein MIMGU_mgv1a004201mg [Mimulus guttatus] Length = 539 Score = 93.2 bits (230), Expect = 3e-16 Identities = 44/53 (83%), Positives = 50/53 (94%) Frame = -1 Query: 160 SCRFITRDELEAAMKEYGMGDEATIKEIISEVDTYNDGRINYDEFCAMMRSGT 2 S +ITRDEL++AMKEYGMGDEATI+EIISEVDT NDG+INY+EFCAMMRSGT Sbjct: 479 SSGYITRDELKSAMKEYGMGDEATIEEIISEVDTDNDGKINYEEFCAMMRSGT 531 >ref|XP_006475136.1| PREDICTED: calcium-dependent protein kinase 9-like [Citrus sinensis] Length = 680 Score = 93.2 bits (230), Expect = 3e-16 Identities = 45/51 (88%), Positives = 47/51 (92%) Frame = -1 Query: 154 RFITRDELEAAMKEYGMGDEATIKEIISEVDTYNDGRINYDEFCAMMRSGT 2 RFIT DELE AMK+YGMGD+ TIKEIISEVDT NDGRINYDEFCAMMRSGT Sbjct: 623 RFITIDELEIAMKDYGMGDDDTIKEIISEVDTDNDGRINYDEFCAMMRSGT 673 Score = 91.3 bits (225), Expect = 1e-15 Identities = 44/50 (88%), Positives = 46/50 (92%) Frame = -1 Query: 151 FITRDELEAAMKEYGMGDEATIKEIISEVDTYNDGRINYDEFCAMMRSGT 2 FIT DELE AMK+YGMGD+ TIKEIISEVDT NDGRINYDEFCAMMRSGT Sbjct: 473 FITIDELEIAMKDYGMGDDDTIKEIISEVDTDNDGRINYDEFCAMMRSGT 522 >ref|XP_006389625.1| hypothetical protein POPTR_0021s00750g [Populus trichocarpa] gi|550312454|gb|ERP48539.1| hypothetical protein POPTR_0021s00750g [Populus trichocarpa] Length = 532 Score = 93.2 bits (230), Expect = 3e-16 Identities = 44/53 (83%), Positives = 49/53 (92%) Frame = -1 Query: 160 SCRFITRDELEAAMKEYGMGDEATIKEIISEVDTYNDGRINYDEFCAMMRSGT 2 S +ITRDELE+AMKEYGMGDEATIKEII+EVD NDG+INY+EFCAMMRSGT Sbjct: 473 SSGYITRDELESAMKEYGMGDEATIKEIIAEVDADNDGKINYEEFCAMMRSGT 525 >ref|XP_006283446.1| hypothetical protein CARUB_v10004493mg [Capsella rubella] gi|482552151|gb|EOA16344.1| hypothetical protein CARUB_v10004493mg [Capsella rubella] Length = 559 Score = 92.8 bits (229), Expect = 4e-16 Identities = 43/50 (86%), Positives = 48/50 (96%) Frame = -1 Query: 151 FITRDELEAAMKEYGMGDEATIKEIISEVDTYNDGRINYDEFCAMMRSGT 2 FIT DELE+AMKEYGMGDEA+IKE+I+EVDT NDGRINY+EFCAMMRSGT Sbjct: 489 FITMDELESAMKEYGMGDEASIKEVIAEVDTDNDGRINYEEFCAMMRSGT 538 >gb|AGG35970.1| calcium-dependent protein kinase 21 [Brassica napus] Length = 525 Score = 92.4 bits (228), Expect = 6e-16 Identities = 43/49 (87%), Positives = 48/49 (97%) Frame = -1 Query: 148 ITRDELEAAMKEYGMGDEATIKEIISEVDTYNDGRINYDEFCAMMRSGT 2 ITRDELE+AMKEYGMGDEA+IKE+ISEVDT NDGRIN++EFCAMMRSGT Sbjct: 466 ITRDELESAMKEYGMGDEASIKEVISEVDTDNDGRINFEEFCAMMRSGT 514 >ref|XP_006396672.1| hypothetical protein EUTSA_v10028567mg [Eutrema salsugineum] gi|557097689|gb|ESQ38125.1| hypothetical protein EUTSA_v10028567mg [Eutrema salsugineum] Length = 535 Score = 92.4 bits (228), Expect = 6e-16 Identities = 43/49 (87%), Positives = 48/49 (97%) Frame = -1 Query: 148 ITRDELEAAMKEYGMGDEATIKEIISEVDTYNDGRINYDEFCAMMRSGT 2 ITRDELE+AMKEYGMGDEA+IKE+ISEVDT NDGRIN++EFCAMMRSGT Sbjct: 476 ITRDELESAMKEYGMGDEASIKEVISEVDTDNDGRINFEEFCAMMRSGT 524 >gb|EPS59225.1| calcium-dependent protein kinase 1, partial [Genlisea aurea] Length = 503 Score = 92.4 bits (228), Expect = 6e-16 Identities = 43/50 (86%), Positives = 47/50 (94%) Frame = -1 Query: 151 FITRDELEAAMKEYGMGDEATIKEIISEVDTYNDGRINYDEFCAMMRSGT 2 +ITRDELE AMK+YGMGDEATI+EIISEVDT NDGRINY+EFC MMRSGT Sbjct: 446 YITRDELETAMKKYGMGDEATIREIISEVDTDNDGRINYEEFCTMMRSGT 495 >ref|XP_006289661.1| hypothetical protein CARUB_v10003219mg [Capsella rubella] gi|482558367|gb|EOA22559.1| hypothetical protein CARUB_v10003219mg [Capsella rubella] Length = 534 Score = 92.4 bits (228), Expect = 6e-16 Identities = 43/49 (87%), Positives = 48/49 (97%) Frame = -1 Query: 148 ITRDELEAAMKEYGMGDEATIKEIISEVDTYNDGRINYDEFCAMMRSGT 2 ITRDELE+AMKEYGMGDEA+IKE+ISEVDT NDGRIN++EFCAMMRSGT Sbjct: 475 ITRDELESAMKEYGMGDEASIKEVISEVDTDNDGRINFEEFCAMMRSGT 523 >ref|XP_002874811.1| calcium-dependent protein kinase 21 [Arabidopsis lyrata subsp. lyrata] gi|297320648|gb|EFH51070.1| calcium-dependent protein kinase 21 [Arabidopsis lyrata subsp. lyrata] Length = 534 Score = 92.4 bits (228), Expect = 6e-16 Identities = 43/49 (87%), Positives = 48/49 (97%) Frame = -1 Query: 148 ITRDELEAAMKEYGMGDEATIKEIISEVDTYNDGRINYDEFCAMMRSGT 2 ITRDELE+AMKEYGMGDEA+IKE+ISEVDT NDGRIN++EFCAMMRSGT Sbjct: 475 ITRDELESAMKEYGMGDEASIKEVISEVDTDNDGRINFEEFCAMMRSGT 523 >ref|XP_006452371.1| hypothetical protein CICLE_v10007983mg [Citrus clementina] gi|557555597|gb|ESR65611.1| hypothetical protein CICLE_v10007983mg [Citrus clementina] Length = 529 Score = 91.3 bits (225), Expect = 1e-15 Identities = 44/50 (88%), Positives = 46/50 (92%) Frame = -1 Query: 151 FITRDELEAAMKEYGMGDEATIKEIISEVDTYNDGRINYDEFCAMMRSGT 2 FIT DELE AMK+YGMGD+ TIKEIISEVDT NDGRINYDEFCAMMRSGT Sbjct: 473 FITIDELEIAMKDYGMGDDDTIKEIISEVDTDNDGRINYDEFCAMMRSGT 522 >ref|XP_004134759.1| PREDICTED: calcium-dependent protein kinase 21-like [Cucumis sativus] gi|449479449|ref|XP_004155602.1| PREDICTED: calcium-dependent protein kinase 21-like [Cucumis sativus] Length = 552 Score = 91.3 bits (225), Expect = 1e-15 Identities = 43/53 (81%), Positives = 48/53 (90%) Frame = -1 Query: 160 SCRFITRDELEAAMKEYGMGDEATIKEIISEVDTYNDGRINYDEFCAMMRSGT 2 S +IT+DELE AMK+YGMGDEA+I+EIISEVDT NDGRINY EFCAMMRSGT Sbjct: 493 SSGYITKDELETAMKDYGMGDEASIREIISEVDTDNDGRINYQEFCAMMRSGT 545