BLASTX nr result
ID: Paeonia22_contig00003623
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00003623 (288 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007025337.1| Ribosomal protein large subunit 16A [Theobro... 73 5e-11 gb|EYU29260.1| hypothetical protein MIMGU_mgv1a014673mg [Mimulus... 72 6e-11 sp|P46287.1|RL11_MEDSA RecName: Full=60S ribosomal protein L11; ... 72 6e-11 emb|CAC12883.1| ribosomal protein L11-like [Nicotiana tabacum] 72 6e-11 ref|XP_007132813.1| hypothetical protein PHAVU_011G126600g [Phas... 72 6e-11 ref|XP_006446820.1| hypothetical protein CICLE_v10016875mg [Citr... 72 6e-11 gb|EPS57537.1| hypothetical protein M569_17280, partial [Genlise... 72 6e-11 ref|XP_004505457.1| PREDICTED: 60S ribosomal protein L11-like [C... 72 6e-11 ref|NP_001266161.1| 60S ribosomal protein L11-like [Cicer arieti... 72 6e-11 ref|XP_003540015.1| PREDICTED: 60S ribosomal protein L11-like [G... 72 6e-11 ref|NP_001237077.1| uncharacterized protein LOC100499863 [Glycin... 72 6e-11 ref|NP_001238636.1| uncharacterized protein LOC100305912 [Glycin... 72 6e-11 ref|XP_002510391.1| 60S ribosomal protein L11, putative [Ricinus... 72 6e-11 ref|XP_002522234.1| 60S ribosomal protein L11, putative [Ricinus... 72 6e-11 gb|ABK93207.1| unknown [Populus trichocarpa] 72 6e-11 ref|XP_002309361.1| 60S ribosomal protein L11 [Populus trichocar... 72 6e-11 gb|EYU21905.1| hypothetical protein MIMGU_mgv1a014651mg [Mimulus... 71 1e-10 ref|XP_006578416.1| PREDICTED: 60S ribosomal protein L11-like [G... 71 1e-10 ref|XP_007148755.1| hypothetical protein PHAVU_005G011400g [Phas... 71 1e-10 ref|XP_006449533.1| hypothetical protein CICLE_v10016873mg [Citr... 71 1e-10 >ref|XP_007025337.1| Ribosomal protein large subunit 16A [Theobroma cacao] gi|508780703|gb|EOY27959.1| Ribosomal protein large subunit 16A [Theobroma cacao] Length = 257 Score = 72.8 bits (177), Expect = 5e-11 Identities = 37/38 (97%), Positives = 38/38 (100%) Frame = +1 Query: 175 SMASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAK 288 +MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAK Sbjct: 75 AMASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAK 112 >gb|EYU29260.1| hypothetical protein MIMGU_mgv1a014673mg [Mimulus guttatus] gi|604341895|gb|EYU41114.1| hypothetical protein MIMGU_mgv1a014638mg [Mimulus guttatus] Length = 182 Score = 72.4 bits (176), Expect = 6e-11 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = +1 Query: 178 MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAK 288 MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAK Sbjct: 1 MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAK 37 >sp|P46287.1|RL11_MEDSA RecName: Full=60S ribosomal protein L11; AltName: Full=L5 gi|463252|emb|CAA55090.1| RL5 ribosomal protein [Medicago sativa] Length = 181 Score = 72.4 bits (176), Expect = 6e-11 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = +1 Query: 178 MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAK 288 MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAK Sbjct: 1 MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAK 37 >emb|CAC12883.1| ribosomal protein L11-like [Nicotiana tabacum] Length = 181 Score = 72.4 bits (176), Expect = 6e-11 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = +1 Query: 178 MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAK 288 MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAK Sbjct: 1 MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAK 37 >ref|XP_007132813.1| hypothetical protein PHAVU_011G126600g [Phaseolus vulgaris] gi|561005813|gb|ESW04807.1| hypothetical protein PHAVU_011G126600g [Phaseolus vulgaris] Length = 181 Score = 72.4 bits (176), Expect = 6e-11 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = +1 Query: 178 MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAK 288 MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAK Sbjct: 1 MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAK 37 >ref|XP_006446820.1| hypothetical protein CICLE_v10016875mg [Citrus clementina] gi|568829354|ref|XP_006468988.1| PREDICTED: 60S ribosomal protein L11-like [Citrus sinensis] gi|557549431|gb|ESR60060.1| hypothetical protein CICLE_v10016875mg [Citrus clementina] Length = 182 Score = 72.4 bits (176), Expect = 6e-11 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = +1 Query: 178 MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAK 288 MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAK Sbjct: 1 MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAK 37 >gb|EPS57537.1| hypothetical protein M569_17280, partial [Genlisea aurea] Length = 75 Score = 72.4 bits (176), Expect = 6e-11 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = +1 Query: 178 MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAK 288 MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAK Sbjct: 25 MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAK 61 >ref|XP_004505457.1| PREDICTED: 60S ribosomal protein L11-like [Cicer arietinum] Length = 181 Score = 72.4 bits (176), Expect = 6e-11 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = +1 Query: 178 MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAK 288 MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAK Sbjct: 1 MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAK 37 >ref|NP_001266161.1| 60S ribosomal protein L11-like [Cicer arietinum] gi|502156356|ref|XP_004510433.1| PREDICTED: 60S ribosomal protein L11-like [Cicer arietinum] gi|502158502|ref|XP_004511177.1| PREDICTED: 60S ribosomal protein L11-like [Cicer arietinum] gi|24817256|emb|CAD56220.1| ribosomal protein RL5 [Cicer arietinum] Length = 181 Score = 72.4 bits (176), Expect = 6e-11 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = +1 Query: 178 MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAK 288 MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAK Sbjct: 1 MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAK 37 >ref|XP_003540015.1| PREDICTED: 60S ribosomal protein L11-like [Glycine max] Length = 181 Score = 72.4 bits (176), Expect = 6e-11 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = +1 Query: 178 MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAK 288 MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAK Sbjct: 1 MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAK 37 >ref|NP_001237077.1| uncharacterized protein LOC100499863 [Glycine max] gi|356517806|ref|XP_003527577.1| PREDICTED: 60S ribosomal protein L11-like [Glycine max] gi|571462385|ref|XP_006582268.1| PREDICTED: 60S ribosomal protein L11-like [Glycine max] gi|571520870|ref|XP_006598073.1| PREDICTED: 60S ribosomal protein L11-like [Glycine max] gi|255627231|gb|ACU13960.1| unknown [Glycine max] gi|255648308|gb|ACU24606.1| unknown [Glycine max] Length = 181 Score = 72.4 bits (176), Expect = 6e-11 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = +1 Query: 178 MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAK 288 MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAK Sbjct: 1 MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAK 37 >ref|NP_001238636.1| uncharacterized protein LOC100305912 [Glycine max] gi|255626957|gb|ACU13823.1| unknown [Glycine max] Length = 181 Score = 72.4 bits (176), Expect = 6e-11 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = +1 Query: 178 MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAK 288 MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAK Sbjct: 1 MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAK 37 >ref|XP_002510391.1| 60S ribosomal protein L11, putative [Ricinus communis] gi|223551092|gb|EEF52578.1| 60S ribosomal protein L11, putative [Ricinus communis] Length = 182 Score = 72.4 bits (176), Expect = 6e-11 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = +1 Query: 178 MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAK 288 MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAK Sbjct: 1 MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAK 37 >ref|XP_002522234.1| 60S ribosomal protein L11, putative [Ricinus communis] gi|223538487|gb|EEF40092.1| 60S ribosomal protein L11, putative [Ricinus communis] Length = 182 Score = 72.4 bits (176), Expect = 6e-11 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = +1 Query: 178 MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAK 288 MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAK Sbjct: 1 MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAK 37 >gb|ABK93207.1| unknown [Populus trichocarpa] Length = 180 Score = 72.4 bits (176), Expect = 6e-11 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = +1 Query: 178 MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAK 288 MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAK Sbjct: 1 MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAK 37 >ref|XP_002309361.1| 60S ribosomal protein L11 [Populus trichocarpa] gi|224091827|ref|XP_002309362.1| 60S ribosomal protein L11-2 [Populus trichocarpa] gi|224116812|ref|XP_002317400.1| ribosomal protein RL5 [Populus trichocarpa] gi|224116816|ref|XP_002317401.1| ribosomal protein RL5 [Populus trichocarpa] gi|118483608|gb|ABK93699.1| unknown [Populus trichocarpa] gi|222855337|gb|EEE92884.1| 60S ribosomal protein L11 [Populus trichocarpa] gi|222855338|gb|EEE92885.1| 60S ribosomal protein L11-2 [Populus trichocarpa] gi|222860465|gb|EEE98012.1| ribosomal protein RL5 [Populus trichocarpa] gi|222860466|gb|EEE98013.1| ribosomal protein RL5 [Populus trichocarpa] Length = 180 Score = 72.4 bits (176), Expect = 6e-11 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = +1 Query: 178 MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAK 288 MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAK Sbjct: 1 MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAK 37 >gb|EYU21905.1| hypothetical protein MIMGU_mgv1a014651mg [Mimulus guttatus] Length = 182 Score = 71.2 bits (173), Expect = 1e-10 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = +1 Query: 178 MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAK 288 MA+EKKLSNPMREIKVQKLVLNISVGESGDRLTRAAK Sbjct: 1 MAAEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAK 37 >ref|XP_006578416.1| PREDICTED: 60S ribosomal protein L11-like [Glycine max] Length = 181 Score = 71.2 bits (173), Expect = 1e-10 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = +1 Query: 178 MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAK 288 MASEKKL+NPMREIKVQKLVLNISVGESGDRLTRAAK Sbjct: 1 MASEKKLANPMREIKVQKLVLNISVGESGDRLTRAAK 37 >ref|XP_007148755.1| hypothetical protein PHAVU_005G011400g [Phaseolus vulgaris] gi|561022019|gb|ESW20749.1| hypothetical protein PHAVU_005G011400g [Phaseolus vulgaris] Length = 181 Score = 71.2 bits (173), Expect = 1e-10 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = +1 Query: 178 MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAK 288 MA+EKKLSNPMREIKVQKLVLNISVGESGDRLTRAAK Sbjct: 1 MAAEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAK 37 >ref|XP_006449533.1| hypothetical protein CICLE_v10016873mg [Citrus clementina] gi|568826525|ref|XP_006467622.1| PREDICTED: 60S ribosomal protein L11-like [Citrus sinensis] gi|557552144|gb|ESR62773.1| hypothetical protein CICLE_v10016873mg [Citrus clementina] Length = 182 Score = 71.2 bits (173), Expect = 1e-10 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = +1 Query: 178 MASEKKLSNPMREIKVQKLVLNISVGESGDRLTRAAK 288 MAS+KKLSNPMREIKVQKLVLNISVGESGDRLTRAAK Sbjct: 1 MASDKKLSNPMREIKVQKLVLNISVGESGDRLTRAAK 37