BLASTX nr result
ID: Paeonia22_contig00003554
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00003554 (322 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|WP_021127132.1| hypothetical protein, partial [[Clostridium]... 82 6e-14 >ref|WP_021127132.1| hypothetical protein, partial [[Clostridium] sordellii] gi|529086653|gb|EPZ62736.1| hypothetical protein H476_3359, partial [Clostridium sordellii VPI 9048] Length = 49 Score = 82.4 bits (202), Expect = 6e-14 Identities = 37/38 (97%), Positives = 38/38 (100%) Frame = -1 Query: 115 VSCRSHPLLTPGGGCGARKYVNNDTGLLTVTRGRDILQ 2 +SCRSHPLLTPGGGCGARKYVNNDTGLLTVTRGRDILQ Sbjct: 1 MSCRSHPLLTPGGGCGARKYVNNDTGLLTVTRGRDILQ 38