BLASTX nr result
ID: Paeonia22_contig00003475
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00003475 (428 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002512385.1| conserved hypothetical protein [Ricinus comm... 99 6e-19 emb|CBI36800.3| unnamed protein product [Vitis vinifera] 98 1e-18 ref|XP_002284540.1| PREDICTED: F-box protein At1g55000-like [Vit... 98 1e-18 ref|XP_007030820.1| Peptidoglycan-binding LysM domain-containing... 98 1e-18 ref|XP_006433336.1| hypothetical protein CICLE_v10002177mg [Citr... 93 4e-17 ref|XP_002319011.2| hypothetical protein POPTR_0013s02260g [Popu... 91 2e-16 gb|EYU29907.1| hypothetical protein MIMGU_mgv1a026468mg [Mimulus... 89 8e-16 gb|EXC55563.1| F-box protein [Morus notabilis] 84 2e-14 ref|XP_004230204.1| PREDICTED: F-box protein At1g55000-like [Sol... 83 4e-14 ref|XP_003556509.2| PREDICTED: F-box protein At1g55000-like [Gly... 81 1e-13 ref|XP_007144727.1| hypothetical protein PHAVU_007G179700g [Phas... 81 2e-13 ref|XP_006344617.1| PREDICTED: F-box protein At1g55000-like [Sol... 80 3e-13 ref|XP_006392469.1| hypothetical protein EUTSA_v10023646mg [Eutr... 80 3e-13 ref|NP_001240110.1| uncharacterized protein LOC100803417 [Glycin... 80 3e-13 ref|XP_004982084.1| PREDICTED: F-box protein At1g55000-like [Set... 79 8e-13 ref|NP_564673.1| F-box protein with LysM domain [Arabidopsis tha... 78 1e-12 emb|CCD74465.1| peptidoglycan-binding LysM domain-containing pro... 78 1e-12 ref|XP_002891932.1| peptidoglycan-binding LysM domain-containing... 78 1e-12 ref|XP_006302705.1| hypothetical protein CARUB_v10020816mg, part... 78 1e-12 ref|XP_004302422.1| PREDICTED: F-box protein At1g55000-like [Fra... 78 1e-12 >ref|XP_002512385.1| conserved hypothetical protein [Ricinus communis] gi|223548346|gb|EEF49837.1| conserved hypothetical protein [Ricinus communis] Length = 260 Score = 99.0 bits (245), Expect = 6e-19 Identities = 47/63 (74%), Positives = 53/63 (84%) Frame = +1 Query: 1 LKCLLNKVTSDHGKRRIIDSLKRSMHVDDGTAEYYLSISNGNPRAALSEFSEDLRWEWQT 180 L CL N TSD GKRRI+DSLKRSM VDDGTA+YYLSISNG+PR A++EFSEDLRWE Q Sbjct: 198 LSCLSNWGTSDQGKRRILDSLKRSMQVDDGTAQYYLSISNGDPRGAITEFSEDLRWERQA 257 Query: 181 GFA 189 G + Sbjct: 258 GLS 260 >emb|CBI36800.3| unnamed protein product [Vitis vinifera] Length = 321 Score = 98.2 bits (243), Expect = 1e-18 Identities = 45/63 (71%), Positives = 55/63 (87%) Frame = +1 Query: 1 LKCLLNKVTSDHGKRRIIDSLKRSMHVDDGTAEYYLSISNGNPRAALSEFSEDLRWEWQT 180 L LLNKV+S+ G+RR+I+SLKRSM +DDGTA+YYLSISNG+PRAA+SEFSEDLRWE Sbjct: 259 LNSLLNKVSSEQGRRRVIESLKRSMQIDDGTAQYYLSISNGDPRAAISEFSEDLRWERHA 318 Query: 181 GFA 189 G + Sbjct: 319 GLS 321 >ref|XP_002284540.1| PREDICTED: F-box protein At1g55000-like [Vitis vinifera] Length = 266 Score = 98.2 bits (243), Expect = 1e-18 Identities = 45/63 (71%), Positives = 55/63 (87%) Frame = +1 Query: 1 LKCLLNKVTSDHGKRRIIDSLKRSMHVDDGTAEYYLSISNGNPRAALSEFSEDLRWEWQT 180 L LLNKV+S+ G+RR+I+SLKRSM +DDGTA+YYLSISNG+PRAA+SEFSEDLRWE Sbjct: 204 LNSLLNKVSSEQGRRRVIESLKRSMQIDDGTAQYYLSISNGDPRAAISEFSEDLRWERHA 263 Query: 181 GFA 189 G + Sbjct: 264 GLS 266 >ref|XP_007030820.1| Peptidoglycan-binding LysM domain-containing protein isoform 1 [Theobroma cacao] gi|508719425|gb|EOY11322.1| Peptidoglycan-binding LysM domain-containing protein isoform 1 [Theobroma cacao] Length = 258 Score = 97.8 bits (242), Expect = 1e-18 Identities = 47/60 (78%), Positives = 52/60 (86%) Frame = +1 Query: 10 LLNKVTSDHGKRRIIDSLKRSMHVDDGTAEYYLSISNGNPRAALSEFSEDLRWEWQTGFA 189 LL +VTSD GKRR+IDSLKRSM VDDGTA+YYLSISNG+PRAALS+FS DL WE Q G A Sbjct: 199 LLKRVTSDRGKRRVIDSLKRSMQVDDGTAQYYLSISNGDPRAALSQFSSDLSWERQIGLA 258 >ref|XP_006433336.1| hypothetical protein CICLE_v10002177mg [Citrus clementina] gi|568835974|ref|XP_006472025.1| PREDICTED: F-box protein At1g55000-like [Citrus sinensis] gi|557535458|gb|ESR46576.1| hypothetical protein CICLE_v10002177mg [Citrus clementina] Length = 265 Score = 92.8 bits (229), Expect = 4e-17 Identities = 46/61 (75%), Positives = 51/61 (83%) Frame = +1 Query: 7 CLLNKVTSDHGKRRIIDSLKRSMHVDDGTAEYYLSISNGNPRAALSEFSEDLRWEWQTGF 186 CLLN+VTS HG+RRII+SL+RSM VDD TA+YYLSISNGN RAALSEFS DL WE Q Sbjct: 205 CLLNRVTSVHGRRRIINSLRRSMQVDDETAQYYLSISNGNLRAALSEFSADLEWERQGAL 264 Query: 187 A 189 A Sbjct: 265 A 265 >ref|XP_002319011.2| hypothetical protein POPTR_0013s02260g [Populus trichocarpa] gi|550324750|gb|EEE94934.2| hypothetical protein POPTR_0013s02260g [Populus trichocarpa] Length = 334 Score = 90.5 bits (223), Expect = 2e-16 Identities = 42/53 (79%), Positives = 47/53 (88%) Frame = +1 Query: 25 TSDHGKRRIIDSLKRSMHVDDGTAEYYLSISNGNPRAALSEFSEDLRWEWQTG 183 +SDHGKRR+IDSLKRSM VDDGTA+YY SISNG+PRAAL+EFS DLRWE G Sbjct: 280 SSDHGKRRVIDSLKRSMQVDDGTAQYYWSISNGDPRAALTEFSADLRWERDAG 332 >gb|EYU29907.1| hypothetical protein MIMGU_mgv1a026468mg [Mimulus guttatus] gi|604329550|gb|EYU34862.1| hypothetical protein MIMGU_mgv1a011682mg [Mimulus guttatus] Length = 274 Score = 88.6 bits (218), Expect = 8e-16 Identities = 41/59 (69%), Positives = 50/59 (84%) Frame = +1 Query: 10 LLNKVTSDHGKRRIIDSLKRSMHVDDGTAEYYLSISNGNPRAALSEFSEDLRWEWQTGF 186 L N T++ GKRR+I+SLKRSM+VDDGTA+YYL+ISNG+PRAALS FSED+ WE Q F Sbjct: 215 LSNSPTTERGKRRVIESLKRSMNVDDGTAQYYLAISNGDPRAALSRFSEDVTWERQVSF 273 >gb|EXC55563.1| F-box protein [Morus notabilis] Length = 272 Score = 84.3 bits (207), Expect = 2e-14 Identities = 40/60 (66%), Positives = 48/60 (80%) Frame = +1 Query: 10 LLNKVTSDHGKRRIIDSLKRSMHVDDGTAEYYLSISNGNPRAALSEFSEDLRWEWQTGFA 189 LL + TS ++R+I SL+RSM VDDGTAEYYLSISNG+PRAA SEFS DLRWE + G + Sbjct: 213 LLQRTTSLQARKRVIHSLRRSMQVDDGTAEYYLSISNGDPRAAFSEFSGDLRWEREVGLS 272 >ref|XP_004230204.1| PREDICTED: F-box protein At1g55000-like [Solanum lycopersicum] Length = 268 Score = 82.8 bits (203), Expect = 4e-14 Identities = 36/61 (59%), Positives = 51/61 (83%) Frame = +1 Query: 1 LKCLLNKVTSDHGKRRIIDSLKRSMHVDDGTAEYYLSISNGNPRAALSEFSEDLRWEWQT 180 L +LN++TS+ K+R+IDSL+RSM VD TA+YYL++S+G+PR+A S+FSEDLRWE + Sbjct: 206 LTTMLNRLTSERSKKRVIDSLRRSMQVDGETAQYYLAVSDGDPRSAFSQFSEDLRWEREA 265 Query: 181 G 183 G Sbjct: 266 G 266 >ref|XP_003556509.2| PREDICTED: F-box protein At1g55000-like [Glycine max] Length = 279 Score = 81.3 bits (199), Expect = 1e-13 Identities = 31/56 (55%), Positives = 48/56 (85%) Frame = +1 Query: 16 NKVTSDHGKRRIIDSLKRSMHVDDGTAEYYLSISNGNPRAALSEFSEDLRWEWQTG 183 N+++S+ +++++SLKRSMHVD+ TA+YY S++NG+PRAA +EFS DL+W+WQ G Sbjct: 222 NRISSEESNKKVLESLKRSMHVDNETAQYYWSVANGDPRAAFAEFSADLKWDWQAG 277 >ref|XP_007144727.1| hypothetical protein PHAVU_007G179700g [Phaseolus vulgaris] gi|561017917|gb|ESW16721.1| hypothetical protein PHAVU_007G179700g [Phaseolus vulgaris] Length = 259 Score = 80.9 bits (198), Expect = 2e-13 Identities = 34/56 (60%), Positives = 48/56 (85%) Frame = +1 Query: 16 NKVTSDHGKRRIIDSLKRSMHVDDGTAEYYLSISNGNPRAALSEFSEDLRWEWQTG 183 N+V+S+ ++++DSLKRSMHVD+ TA+YY S+SNG+PRAAL+EFS DL+W+ Q G Sbjct: 202 NRVSSEESNKKVVDSLKRSMHVDNETAQYYWSVSNGDPRAALAEFSADLKWDRQAG 257 >ref|XP_006344617.1| PREDICTED: F-box protein At1g55000-like [Solanum tuberosum] Length = 268 Score = 80.1 bits (196), Expect = 3e-13 Identities = 34/61 (55%), Positives = 50/61 (81%) Frame = +1 Query: 1 LKCLLNKVTSDHGKRRIIDSLKRSMHVDDGTAEYYLSISNGNPRAALSEFSEDLRWEWQT 180 L +LN++TS+ K+R+IDSL+RSM VD TA+YY ++S+G+PR+A S+FSEDL+WE + Sbjct: 206 LTTMLNRLTSERSKKRVIDSLRRSMQVDGETAQYYFAVSDGDPRSAFSQFSEDLKWEREA 265 Query: 181 G 183 G Sbjct: 266 G 266 >ref|XP_006392469.1| hypothetical protein EUTSA_v10023646mg [Eutrema salsugineum] gi|567130193|ref|XP_006392470.1| hypothetical protein EUTSA_v10023646mg [Eutrema salsugineum] gi|557088975|gb|ESQ29755.1| hypothetical protein EUTSA_v10023646mg [Eutrema salsugineum] gi|557088976|gb|ESQ29756.1| hypothetical protein EUTSA_v10023646mg [Eutrema salsugineum] Length = 260 Score = 80.1 bits (196), Expect = 3e-13 Identities = 37/50 (74%), Positives = 43/50 (86%) Frame = +1 Query: 34 HGKRRIIDSLKRSMHVDDGTAEYYLSISNGNPRAALSEFSEDLRWEWQTG 183 HGKRR+IDSL+RSM VDDGTA YYL+I+ G+PR+ALSEFS DL WE Q G Sbjct: 209 HGKRRLIDSLRRSMQVDDGTALYYLAIAEGDPRSALSEFSADLTWERQAG 258 >ref|NP_001240110.1| uncharacterized protein LOC100803417 [Glycine max] gi|255642335|gb|ACU21432.1| unknown [Glycine max] Length = 263 Score = 80.1 bits (196), Expect = 3e-13 Identities = 30/56 (53%), Positives = 48/56 (85%) Frame = +1 Query: 16 NKVTSDHGKRRIIDSLKRSMHVDDGTAEYYLSISNGNPRAALSEFSEDLRWEWQTG 183 N+++S+ +++++SLKRSMHVD+ TA+YY S++NG+PRAA ++FS DL+W+WQ G Sbjct: 206 NRISSEESNKKVLESLKRSMHVDNETAQYYWSVANGDPRAAFAQFSADLKWDWQAG 261 >ref|XP_004982084.1| PREDICTED: F-box protein At1g55000-like [Setaria italica] Length = 250 Score = 78.6 bits (192), Expect = 8e-13 Identities = 34/56 (60%), Positives = 46/56 (82%) Frame = +1 Query: 10 LLNKVTSDHGKRRIIDSLKRSMHVDDGTAEYYLSISNGNPRAALSEFSEDLRWEWQ 177 L N ++ + RRI++S++RS+HVDDGTA YYLS+S G+PRAA+ E+SEDLRWE Q Sbjct: 191 LANIISKERRSRRILESVRRSLHVDDGTAAYYLSVSEGDPRAAMMEYSEDLRWEQQ 246 >ref|NP_564673.1| F-box protein with LysM domain [Arabidopsis thaliana] gi|79319963|ref|NP_001031192.1| F-box protein with LysM domain [Arabidopsis thaliana] gi|79319984|ref|NP_001031193.1| F-box protein with LysM domain [Arabidopsis thaliana] gi|75263250|sp|Q9FZ32.1|FB60_ARATH RecName: Full=F-box protein At1g55000 gi|9857524|gb|AAG00879.1|AC064840_10 Unknown protein [Arabidopsis thaliana] gi|12322164|gb|AAG51120.1|AC069144_17 unknown protein [Arabidopsis thaliana] gi|15983460|gb|AAL11598.1|AF424604_1 At1g55000/F14C21_4 [Arabidopsis thaliana] gi|21593342|gb|AAM65291.1| unknown [Arabidopsis thaliana] gi|21700829|gb|AAM70538.1| At1g55000/F14C21_4 [Arabidopsis thaliana] gi|222423439|dbj|BAH19690.1| AT1G55000 [Arabidopsis thaliana] gi|222423553|dbj|BAH19746.1| AT1G55000 [Arabidopsis thaliana] gi|332195050|gb|AEE33171.1| F-box protein with LysM domain [Arabidopsis thaliana] gi|332195051|gb|AEE33172.1| F-box protein with LysM domain [Arabidopsis thaliana] gi|332195052|gb|AEE33173.1| F-box protein with LysM domain [Arabidopsis thaliana] Length = 221 Score = 78.2 bits (191), Expect = 1e-12 Identities = 37/52 (71%), Positives = 44/52 (84%) Frame = +1 Query: 28 SDHGKRRIIDSLKRSMHVDDGTAEYYLSISNGNPRAALSEFSEDLRWEWQTG 183 S GKRR+I+SL+RSM VDDGTA YYL+I+ G+PR+ALSEFS DLRWE Q G Sbjct: 168 SADGKRRLIESLRRSMQVDDGTALYYLAIAEGDPRSALSEFSADLRWERQAG 219 >emb|CCD74465.1| peptidoglycan-binding LysM domain-containing protein [Arabidopsis halleri subsp. halleri] Length = 547 Score = 78.2 bits (191), Expect = 1e-12 Identities = 37/52 (71%), Positives = 44/52 (84%) Frame = +1 Query: 28 SDHGKRRIIDSLKRSMHVDDGTAEYYLSISNGNPRAALSEFSEDLRWEWQTG 183 S GKRR+I+SL+RSM VDDGTA YYL+I+ G+PR+ALSEFS DLRWE Q G Sbjct: 494 SADGKRRLIESLRRSMQVDDGTALYYLAIAEGDPRSALSEFSADLRWERQAG 545 >ref|XP_002891932.1| peptidoglycan-binding LysM domain-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297337774|gb|EFH68191.1| peptidoglycan-binding LysM domain-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 221 Score = 78.2 bits (191), Expect = 1e-12 Identities = 37/52 (71%), Positives = 44/52 (84%) Frame = +1 Query: 28 SDHGKRRIIDSLKRSMHVDDGTAEYYLSISNGNPRAALSEFSEDLRWEWQTG 183 S GKRR+I+SL+RSM VDDGTA YYL+I+ G+PR+ALSEFS DLRWE Q G Sbjct: 168 SADGKRRLIESLRRSMQVDDGTALYYLAIAEGDPRSALSEFSADLRWERQAG 219 >ref|XP_006302705.1| hypothetical protein CARUB_v10020816mg, partial [Capsella rubella] gi|482571415|gb|EOA35603.1| hypothetical protein CARUB_v10020816mg, partial [Capsella rubella] Length = 262 Score = 77.8 bits (190), Expect = 1e-12 Identities = 38/59 (64%), Positives = 49/59 (83%), Gaps = 2/59 (3%) Frame = +1 Query: 13 LNKVT--SDHGKRRIIDSLKRSMHVDDGTAEYYLSISNGNPRAALSEFSEDLRWEWQTG 183 +NK++ S GKRR+I+SL+RSM VDDGTA YYL+I+ G+PR+ALSEFS DL+WE Q G Sbjct: 202 MNKLSNLSADGKRRLIESLRRSMQVDDGTALYYLAIAEGDPRSALSEFSADLKWERQAG 260 >ref|XP_004302422.1| PREDICTED: F-box protein At1g55000-like [Fragaria vesca subsp. vesca] Length = 268 Score = 77.8 bits (190), Expect = 1e-12 Identities = 35/54 (64%), Positives = 47/54 (87%) Frame = +1 Query: 28 SDHGKRRIIDSLKRSMHVDDGTAEYYLSISNGNPRAALSEFSEDLRWEWQTGFA 189 S+ GK+R+++SL+RSM VDD TA YYLSI++G+PRAALS+FS+DLRWE + FA Sbjct: 215 SELGKKRVLESLRRSMQVDDATALYYLSIADGDPRAALSQFSQDLRWESHSAFA 268