BLASTX nr result
ID: Paeonia22_contig00002752
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00002752 (326 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007012271.1| Uncharacterized protein isoform 1 [Theobroma... 59 5e-07 ref|XP_007226043.1| hypothetical protein PRUPE_ppa010598mg [Prun... 56 6e-06 >ref|XP_007012271.1| Uncharacterized protein isoform 1 [Theobroma cacao] gi|590573980|ref|XP_007012272.1| Uncharacterized protein isoform 1 [Theobroma cacao] gi|590573983|ref|XP_007012273.1| Uncharacterized protein isoform 1 [Theobroma cacao] gi|508782634|gb|EOY29890.1| Uncharacterized protein isoform 1 [Theobroma cacao] gi|508782635|gb|EOY29891.1| Uncharacterized protein isoform 1 [Theobroma cacao] gi|508782636|gb|EOY29892.1| Uncharacterized protein isoform 1 [Theobroma cacao] Length = 243 Score = 59.3 bits (142), Expect = 5e-07 Identities = 28/34 (82%), Positives = 31/34 (91%), Gaps = 1/34 (2%) Frame = +1 Query: 226 GRLPIMELKPAYDVEDMKST-QIQHELWPLDEID 324 GRLPIM+LK AYDVEDM ST +IQH+LWPLDEID Sbjct: 4 GRLPIMDLKSAYDVEDMSSTSRIQHDLWPLDEID 37 >ref|XP_007226043.1| hypothetical protein PRUPE_ppa010598mg [Prunus persica] gi|462422979|gb|EMJ27242.1| hypothetical protein PRUPE_ppa010598mg [Prunus persica] Length = 243 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/33 (78%), Positives = 29/33 (87%), Gaps = 1/33 (3%) Frame = +1 Query: 229 RLPIMELKPAYDVEDMKSTQ-IQHELWPLDEID 324 R P+ME+K AYDVE M+STQ IQHELWPLDEID Sbjct: 5 RFPVMEVKEAYDVEHMRSTQSIQHELWPLDEID 37