BLASTX nr result
ID: Paeonia22_contig00002529
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00002529 (368 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006417433.1| hypothetical protein EUTSA_v10008114mg [Eutr... 56 6e-06 ref|XP_006417432.1| hypothetical protein EUTSA_v10008114mg [Eutr... 56 6e-06 ref|XP_006392112.1| hypothetical protein EUTSA_v10023479mg [Eutr... 56 6e-06 ref|XP_004488606.1| PREDICTED: ATP-citrate synthase alpha chain ... 56 6e-06 ref|XP_006306091.1| hypothetical protein CARUB_v10011514mg [Caps... 56 6e-06 ref|XP_004142973.1| PREDICTED: ATP-citrate synthase alpha chain ... 56 6e-06 ref|XP_002525398.1| ATP-citrate synthase, putative [Ricinus comm... 56 6e-06 >ref|XP_006417433.1| hypothetical protein EUTSA_v10008114mg [Eutrema salsugineum] gi|557095204|gb|ESQ35786.1| hypothetical protein EUTSA_v10008114mg [Eutrema salsugineum] Length = 342 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/33 (72%), Positives = 28/33 (84%) Frame = +1 Query: 1 EFPMPFGRVMSPTESFIHGLDEKVSIGVSLSLI 99 EFPMPFGRVMSPTESFIHGLDEK S + +++ Sbjct: 234 EFPMPFGRVMSPTESFIHGLDEKTSASLKFTVL 266 >ref|XP_006417432.1| hypothetical protein EUTSA_v10008114mg [Eutrema salsugineum] gi|557095203|gb|ESQ35785.1| hypothetical protein EUTSA_v10008114mg [Eutrema salsugineum] Length = 248 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/33 (72%), Positives = 28/33 (84%) Frame = +1 Query: 1 EFPMPFGRVMSPTESFIHGLDEKVSIGVSLSLI 99 EFPMPFGRVMSPTESFIHGLDEK S + +++ Sbjct: 140 EFPMPFGRVMSPTESFIHGLDEKTSASLKFTVL 172 >ref|XP_006392112.1| hypothetical protein EUTSA_v10023479mg [Eutrema salsugineum] gi|567128892|ref|XP_006392113.1| hypothetical protein EUTSA_v10023479mg [Eutrema salsugineum] gi|557088618|gb|ESQ29398.1| hypothetical protein EUTSA_v10023479mg [Eutrema salsugineum] gi|557088619|gb|ESQ29399.1| hypothetical protein EUTSA_v10023479mg [Eutrema salsugineum] Length = 423 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/33 (72%), Positives = 28/33 (84%) Frame = +1 Query: 1 EFPMPFGRVMSPTESFIHGLDEKVSIGVSLSLI 99 EFPMPFGRVMSPTESFIHGLDEK S + +++ Sbjct: 234 EFPMPFGRVMSPTESFIHGLDEKTSASLKFTVL 266 >ref|XP_004488606.1| PREDICTED: ATP-citrate synthase alpha chain protein 2-like isoform X1 [Cicer arietinum] gi|502087676|ref|XP_004488607.1| PREDICTED: ATP-citrate synthase alpha chain protein 2-like isoform X2 [Cicer arietinum] Length = 423 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/33 (72%), Positives = 28/33 (84%) Frame = +1 Query: 1 EFPMPFGRVMSPTESFIHGLDEKVSIGVSLSLI 99 EFPMPFGRVMSPTESFIHGLDEK S + +++ Sbjct: 234 EFPMPFGRVMSPTESFIHGLDEKTSASLKFTVL 266 >ref|XP_006306091.1| hypothetical protein CARUB_v10011514mg [Capsella rubella] gi|482574802|gb|EOA38989.1| hypothetical protein CARUB_v10011514mg [Capsella rubella] Length = 423 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/33 (72%), Positives = 28/33 (84%) Frame = +1 Query: 1 EFPMPFGRVMSPTESFIHGLDEKVSIGVSLSLI 99 EFPMPFGRVMSPTESFIHGLDEK S + +++ Sbjct: 234 EFPMPFGRVMSPTESFIHGLDEKTSASLKFTVL 266 >ref|XP_004142973.1| PREDICTED: ATP-citrate synthase alpha chain protein 1-like [Cucumis sativus] Length = 423 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/33 (72%), Positives = 28/33 (84%) Frame = +1 Query: 1 EFPMPFGRVMSPTESFIHGLDEKVSIGVSLSLI 99 EFPMPFGRVMSPTESFIHGLDEK S + +++ Sbjct: 234 EFPMPFGRVMSPTESFIHGLDEKTSASLKFTVL 266 >ref|XP_002525398.1| ATP-citrate synthase, putative [Ricinus communis] gi|223535361|gb|EEF37036.1| ATP-citrate synthase, putative [Ricinus communis] Length = 423 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/33 (72%), Positives = 28/33 (84%) Frame = +1 Query: 1 EFPMPFGRVMSPTESFIHGLDEKVSIGVSLSLI 99 EFPMPFGRVMSPTESFIHGLDEK S + +++ Sbjct: 234 EFPMPFGRVMSPTESFIHGLDEKTSASLKFTVL 266