BLASTX nr result
ID: Paeonia22_contig00001086
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00001086 (215 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXC24673.1| hypothetical protein L484_008444 [Morus notabilis] 62 1e-07 gb|AEA41713.1| squalene synthase [Eleutherococcus senticosus] gi... 61 1e-07 gb|AEA41712.1| squalene synthase [Eleutherococcus senticosus] gi... 61 1e-07 gb|ACV88718.1| squalene synthase [Panax ginseng] 61 1e-07 emb|CAJ58419.1| squalene synthase [Panax quinquefolius] 61 1e-07 emb|CAJ58418.1| squalene synthase [Panax quinquefolius] 61 1e-07 gb|AAV58897.1| squalene synthase [Centella asiatica] 61 1e-07 ref|XP_007042047.1| Squalene synthase 1 isoform 1 [Theobroma cac... 60 2e-07 gb|ABX10442.1| squalene synthase 2 [Gossypium hirsutum] 60 2e-07 gb|ACZ71037.1| squalene synthase [Panax ginseng] 60 4e-07 ref|XP_002512982.1| farnesyl-diphosphate farnesyltransferase, pu... 59 5e-07 gb|AGB05603.1| squalene synthase [Camellia oleifera] 59 7e-07 ref|XP_002266150.1| PREDICTED: squalene synthase [Vitis vinifera... 59 7e-07 ref|XP_006283828.1| hypothetical protein CARUB_v10004929mg [Caps... 58 1e-06 ref|NP_195190.1| Squalene synthase 1 [Arabidopsis thaliana] gi|1... 58 1e-06 ref|XP_002869133.1| hypothetical protein ARALYDRAFT_912921 [Arab... 58 1e-06 dbj|BAA82093.1| squalene synthase [Solanum tuberosum] 58 2e-06 dbj|BAA13083.1| squalene synthase [Glycyrrhiza glabra] 58 2e-06 ref|XP_006362006.1| PREDICTED: squalene synthase-like isoform X1... 58 2e-06 ref|XP_007042048.1| Squalene synthase 1 isoform 2 [Theobroma cac... 58 2e-06 >gb|EXC24673.1| hypothetical protein L484_008444 [Morus notabilis] Length = 411 Score = 61.6 bits (148), Expect = 1e-07 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = +1 Query: 1 GLTAKIFDRTNSMSDVYGAFYDFSCMLKSKV 93 GLTAK+ DRTN+M+DVYGAFYDFSCMLKSKV Sbjct: 316 GLTAKVIDRTNTMADVYGAFYDFSCMLKSKV 346 >gb|AEA41713.1| squalene synthase [Eleutherococcus senticosus] gi|327243165|gb|AEA41715.1| squalene synthase [Eleutherococcus senticosus] gi|327243169|gb|AEA41717.1| squalene synthase [Eleutherococcus senticosus] Length = 415 Score = 61.2 bits (147), Expect = 1e-07 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = +1 Query: 1 GLTAKIFDRTNSMSDVYGAFYDFSCMLKSKV 93 GLTAK+ DRTN+MSDVYGAF+DFSCMLKSKV Sbjct: 316 GLTAKVIDRTNTMSDVYGAFFDFSCMLKSKV 346 >gb|AEA41712.1| squalene synthase [Eleutherococcus senticosus] gi|327243163|gb|AEA41714.1| squalene synthase [Eleutherococcus senticosus] gi|327243167|gb|AEA41716.1| squalene synthase [Eleutherococcus senticosus] Length = 415 Score = 61.2 bits (147), Expect = 1e-07 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = +1 Query: 1 GLTAKIFDRTNSMSDVYGAFYDFSCMLKSKV 93 GLTAK+ DRTN+MSDVYGAF+DFSCMLKSKV Sbjct: 316 GLTAKVIDRTNTMSDVYGAFFDFSCMLKSKV 346 >gb|ACV88718.1| squalene synthase [Panax ginseng] Length = 415 Score = 61.2 bits (147), Expect = 1e-07 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = +1 Query: 1 GLTAKIFDRTNSMSDVYGAFYDFSCMLKSKV 93 GLTAK+ DRTN+MSDVYGAF+DFSCMLKSKV Sbjct: 316 GLTAKVIDRTNTMSDVYGAFFDFSCMLKSKV 346 >emb|CAJ58419.1| squalene synthase [Panax quinquefolius] Length = 415 Score = 61.2 bits (147), Expect = 1e-07 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = +1 Query: 1 GLTAKIFDRTNSMSDVYGAFYDFSCMLKSKV 93 GLTAK+ DRTN+MSDVYGAF+DFSCMLKSKV Sbjct: 316 GLTAKVIDRTNTMSDVYGAFFDFSCMLKSKV 346 >emb|CAJ58418.1| squalene synthase [Panax quinquefolius] Length = 415 Score = 61.2 bits (147), Expect = 1e-07 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = +1 Query: 1 GLTAKIFDRTNSMSDVYGAFYDFSCMLKSKV 93 GLTAK+ DRTN+MSDVYGAF+DFSCMLKSKV Sbjct: 316 GLTAKVIDRTNTMSDVYGAFFDFSCMLKSKV 346 >gb|AAV58897.1| squalene synthase [Centella asiatica] Length = 415 Score = 61.2 bits (147), Expect = 1e-07 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = +1 Query: 1 GLTAKIFDRTNSMSDVYGAFYDFSCMLKSKV 93 GLTAK+ DRTN MSDVYGAFYDFSCMLK+KV Sbjct: 316 GLTAKVIDRTNKMSDVYGAFYDFSCMLKTKV 346 >ref|XP_007042047.1| Squalene synthase 1 isoform 1 [Theobroma cacao] gi|508705982|gb|EOX97878.1| Squalene synthase 1 isoform 1 [Theobroma cacao] Length = 413 Score = 60.5 bits (145), Expect = 2e-07 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = +1 Query: 1 GLTAKIFDRTNSMSDVYGAFYDFSCMLKSKV 93 GLTAK+ DRTN+M+DVYGAFYDFSCMLK+KV Sbjct: 316 GLTAKVIDRTNTMADVYGAFYDFSCMLKAKV 346 >gb|ABX10442.1| squalene synthase 2 [Gossypium hirsutum] Length = 412 Score = 60.5 bits (145), Expect = 2e-07 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = +1 Query: 1 GLTAKIFDRTNSMSDVYGAFYDFSCMLKSKV 93 GLTAK+ DRTN+M+DVYGAFYDFSCMLK+KV Sbjct: 316 GLTAKVIDRTNTMADVYGAFYDFSCMLKAKV 346 >gb|ACZ71037.1| squalene synthase [Panax ginseng] Length = 415 Score = 59.7 bits (143), Expect = 4e-07 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = +1 Query: 1 GLTAKIFDRTNSMSDVYGAFYDFSCMLKSKV 93 GLTAK+ DRTN+MSDVYG F+DFSCMLKSKV Sbjct: 316 GLTAKVIDRTNTMSDVYGTFFDFSCMLKSKV 346 >ref|XP_002512982.1| farnesyl-diphosphate farnesyltransferase, putative [Ricinus communis] gi|223547993|gb|EEF49485.1| farnesyl-diphosphate farnesyltransferase, putative [Ricinus communis] Length = 412 Score = 59.3 bits (142), Expect = 5e-07 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = +1 Query: 1 GLTAKIFDRTNSMSDVYGAFYDFSCMLKSKV 93 GLTAK+ DRT +M+DVYGAFYDFSCMLKSKV Sbjct: 316 GLTAKVIDRTKTMADVYGAFYDFSCMLKSKV 346 >gb|AGB05603.1| squalene synthase [Camellia oleifera] Length = 414 Score = 58.9 bits (141), Expect = 7e-07 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = +1 Query: 1 GLTAKIFDRTNSMSDVYGAFYDFSCMLKSKV 93 GLTAK+ DRT +MSDVYGAF+DFSCMLKSKV Sbjct: 316 GLTAKVIDRTKTMSDVYGAFFDFSCMLKSKV 346 >ref|XP_002266150.1| PREDICTED: squalene synthase [Vitis vinifera] gi|297744746|emb|CBI38008.3| unnamed protein product [Vitis vinifera] Length = 413 Score = 58.9 bits (141), Expect = 7e-07 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = +1 Query: 1 GLTAKIFDRTNSMSDVYGAFYDFSCMLKSKV 93 GLTAK+ DRT +MSDVYGAF+DFSCMLKSKV Sbjct: 316 GLTAKVIDRTKAMSDVYGAFFDFSCMLKSKV 346 >ref|XP_006283828.1| hypothetical protein CARUB_v10004929mg [Capsella rubella] gi|482552533|gb|EOA16726.1| hypothetical protein CARUB_v10004929mg [Capsella rubella] Length = 414 Score = 58.2 bits (139), Expect = 1e-06 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = +1 Query: 1 GLTAKIFDRTNSMSDVYGAFYDFSCMLKSKV 93 GLTAK+ DRT +M+DVYGAFYDFSCMLK+KV Sbjct: 318 GLTAKVIDRTKTMADVYGAFYDFSCMLKTKV 348 >ref|NP_195190.1| Squalene synthase 1 [Arabidopsis thaliana] gi|1706772|sp|P53799.1|FDFT_ARATH RecName: Full=Squalene synthase; Short=SQS; Short=SS; AltName: Full=FPP:FPP farnesyltransferase; AltName: Full=Farnesyl-diphosphate farnesyltransferase gi|798820|emb|CAA60385.1| farnesyl-diphosphate farnesyltransferase [Arabidopsis thaliana] gi|806325|dbj|BAA06103.1| squalene synthase [Arabidopsis thaliana] gi|2232212|gb|AAB62242.1| squalene synthase 1 [Arabidopsis thaliana] gi|3096933|emb|CAA18843.1| farnesyl-diphosphate farnesyltransferase [Arabidopsis thaliana] gi|4098519|gb|AAD00296.1| squalene synthase [Arabidopsis thaliana] gi|7270414|emb|CAB80181.1| farnesyl-diphosphate farnesyltransferase [Arabidopsis thaliana] gi|20466804|gb|AAM20719.1| putative squalene synthase [Arabidopsis thaliana] gi|28059678|gb|AAO30082.1| putative squalene synthase [Arabidopsis thaliana] gi|332661003|gb|AEE86403.1| Squalene synthase [Arabidopsis thaliana] Length = 410 Score = 58.2 bits (139), Expect = 1e-06 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = +1 Query: 1 GLTAKIFDRTNSMSDVYGAFYDFSCMLKSKV 93 GLTAK+ DRT +M+DVYGAFYDFSCMLK+KV Sbjct: 318 GLTAKVIDRTKTMADVYGAFYDFSCMLKTKV 348 >ref|XP_002869133.1| hypothetical protein ARALYDRAFT_912921 [Arabidopsis lyrata subsp. lyrata] gi|297314969|gb|EFH45392.1| hypothetical protein ARALYDRAFT_912921 [Arabidopsis lyrata subsp. lyrata] Length = 412 Score = 58.2 bits (139), Expect = 1e-06 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = +1 Query: 1 GLTAKIFDRTNSMSDVYGAFYDFSCMLKSKV 93 GLTAK+ DRT +M+DVYGAFYDFSCMLK+KV Sbjct: 318 GLTAKVIDRTKTMADVYGAFYDFSCMLKTKV 348 >dbj|BAA82093.1| squalene synthase [Solanum tuberosum] Length = 411 Score = 57.8 bits (138), Expect = 2e-06 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = +1 Query: 1 GLTAKIFDRTNSMSDVYGAFYDFSCMLKSKV 93 GLTAK+ DRT +M+DVYGAF+DFSCMLKSKV Sbjct: 316 GLTAKVIDRTKTMADVYGAFFDFSCMLKSKV 346 >dbj|BAA13083.1| squalene synthase [Glycyrrhiza glabra] Length = 413 Score = 57.8 bits (138), Expect = 2e-06 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = +1 Query: 1 GLTAKIFDRTNSMSDVYGAFYDFSCMLKSKV 93 GLTAK+ DRT +M+DVYGAF+DFSCMLKSKV Sbjct: 316 GLTAKVIDRTKTMADVYGAFFDFSCMLKSKV 346 >ref|XP_006362006.1| PREDICTED: squalene synthase-like isoform X1 [Solanum tuberosum] gi|565392653|ref|XP_006362007.1| PREDICTED: squalene synthase-like isoform X2 [Solanum tuberosum] gi|565392655|ref|XP_006362008.1| PREDICTED: squalene synthase-like isoform X3 [Solanum tuberosum] Length = 411 Score = 57.8 bits (138), Expect = 2e-06 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = +1 Query: 1 GLTAKIFDRTNSMSDVYGAFYDFSCMLKSKV 93 GLTAK+ DRT +M+DVYGAF+DFSCMLKSKV Sbjct: 316 GLTAKVIDRTKTMADVYGAFFDFSCMLKSKV 346 >ref|XP_007042048.1| Squalene synthase 1 isoform 2 [Theobroma cacao] gi|590685243|ref|XP_007042049.1| Squalene synthase 1 isoform 2 [Theobroma cacao] gi|508705983|gb|EOX97879.1| Squalene synthase 1 isoform 2 [Theobroma cacao] gi|508705984|gb|EOX97880.1| Squalene synthase 1 isoform 2 [Theobroma cacao] Length = 305 Score = 57.8 bits (138), Expect = 2e-06 Identities = 24/30 (80%), Positives = 29/30 (96%) Frame = +1 Query: 1 GLTAKIFDRTNSMSDVYGAFYDFSCMLKSK 90 GLTAK+ DRTN+M+DVYGAFYDFSCMLK++ Sbjct: 274 GLTAKVIDRTNTMADVYGAFYDFSCMLKAR 303