BLASTX nr result
ID: Paeonia22_contig00000869
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00000869 (622 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAE12163.1| expansin-like protein [Quercus robur] 57 6e-06 >emb|CAE12163.1| expansin-like protein [Quercus robur] Length = 265 Score = 56.6 bits (135), Expect = 6e-06 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = -3 Query: 620 VLSSRAFMAMAQKGMDQNILKLGIVDVEYKR 528 V+SSRAFMAMAQKGM Q+ILKLGIVDVEYKR Sbjct: 110 VVSSRAFMAMAQKGMGQDILKLGIVDVEYKR 140