BLASTX nr result
ID: Paeonia22_contig00000372
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00000372 (275 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value sp|Q96386.1|MT3_CARPA RecName: Full=Metallothionein-like protein... 58 1e-06 emb|CAA07565.1| metallothionein-like protein [Ribes nigrum] 56 5e-06 >sp|Q96386.1|MT3_CARPA RecName: Full=Metallothionein-like protein type 3; Short=MT-3 gi|1566700|emb|CAA69624.1| metallothionein-like protein [Carica papaya] gi|354464673|gb|AER26532.1| metallothionein-like protein [Carica papaya] Length = 65 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/36 (75%), Positives = 31/36 (86%) Frame = -2 Query: 274 DKTQCVKKGNGYGLDIIETQKSYDTVVIDAPASEND 167 DKTQCVKKG+ Y DIIET+KS TVV+DAPA+END Sbjct: 12 DKTQCVKKGSSYTADIIETEKSIMTVVMDAPAAEND 47 >emb|CAA07565.1| metallothionein-like protein [Ribes nigrum] Length = 65 Score = 56.2 bits (134), Expect = 5e-06 Identities = 27/37 (72%), Positives = 29/37 (78%), Gaps = 1/37 (2%) Frame = -2 Query: 274 DKTQCVKKGNGYGLDIIETQKSYDTVVI-DAPASEND 167 DKT C KKGN YG DIIETQKSYD VV+ D A+END Sbjct: 11 DKTNCPKKGNSYGFDIIETQKSYDDVVVMDVQAAEND 47