BLASTX nr result
ID: Paeonia22_contig00000038
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00000038 (299 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002514534.1| s-adenosylmethionine decarboxylase, putative... 57 4e-06 gb|AFJ04521.1| s-adenosylmethionine decarboxylase, partial [Vern... 55 8e-06 >ref|XP_002514534.1| s-adenosylmethionine decarboxylase, putative [Ricinus communis] gi|223546138|gb|EEF47640.1| s-adenosylmethionine decarboxylase, putative [Ricinus communis] Length = 361 Score = 56.6 bits (135), Expect = 4e-06 Identities = 26/36 (72%), Positives = 30/36 (83%) Frame = -1 Query: 299 RSFEELGMGGGGIVYKRFVRDVSVGSPRSTLRCCWK 192 RSFEELGMGG IVY++FVR GSPRSTL+CCW+ Sbjct: 319 RSFEELGMGGS-IVYQKFVRTGDSGSPRSTLKCCWR 353 >gb|AFJ04521.1| s-adenosylmethionine decarboxylase, partial [Vernicia fordii] Length = 293 Score = 55.5 bits (132), Expect = 8e-06 Identities = 26/36 (72%), Positives = 29/36 (80%) Frame = -1 Query: 299 RSFEELGMGGGGIVYKRFVRDVSVGSPRSTLRCCWK 192 RSFEELGMGG IVY++F R GSPRSTL+CCWK Sbjct: 251 RSFEELGMGGS-IVYQKFERTGDSGSPRSTLKCCWK 285