BLASTX nr result
ID: Ophiopogon26_contig00020453
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00020453 (390 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK59479.1| uncharacterized protein A4U43_C08F6850 [Asparagus... 72 3e-12 ref|XP_009395916.1| PREDICTED: glutamic acid-rich protein [Musa ... 60 2e-08 ref|XP_020242673.1| glutamic acid-rich protein-like [Asparagus o... 54 4e-06 ref|XP_020687644.1| glutamic acid-rich protein-like [Dendrobium ... 53 9e-06 >gb|ONK59479.1| uncharacterized protein A4U43_C08F6850 [Asparagus officinalis] Length = 348 Score = 72.0 bits (175), Expect = 3e-12 Identities = 32/47 (68%), Positives = 37/47 (78%) Frame = -3 Query: 223 FQEDVILPSLPNIDNMTNEEKLLIRSKYKLEHFWLGSCYHLELEAFP 83 F EDV LPSLP++ M+ EEKLLI SKY+LE FW+ SCYHLE AFP Sbjct: 192 FPEDVTLPSLPDVGTMSKEEKLLIASKYRLEQFWVTSCYHLEQNAFP 238 >ref|XP_009395916.1| PREDICTED: glutamic acid-rich protein [Musa acuminata subsp. malaccensis] ref|XP_018680444.1| PREDICTED: glutamic acid-rich protein [Musa acuminata subsp. malaccensis] Length = 216 Score = 60.5 bits (145), Expect = 2e-08 Identities = 26/42 (61%), Positives = 34/42 (80%) Frame = -3 Query: 223 FQEDVILPSLPNIDNMTNEEKLLIRSKYKLEHFWLGSCYHLE 98 F EDV LPS+P++D ++NE K LI SK KLE+FW GSCY+L+ Sbjct: 34 FPEDVTLPSVPSVDPLSNEVKALIASKIKLEYFWKGSCYNLQ 75 >ref|XP_020242673.1| glutamic acid-rich protein-like [Asparagus officinalis] Length = 173 Score = 53.5 bits (127), Expect = 4e-06 Identities = 23/32 (71%), Positives = 26/32 (81%) Frame = -3 Query: 178 MTNEEKLLIRSKYKLEHFWLGSCYHLELEAFP 83 M+ EEKLLI SKY+LE FW+ SCYHLE AFP Sbjct: 1 MSKEEKLLIASKYRLEQFWVTSCYHLEQNAFP 32 >ref|XP_020687644.1| glutamic acid-rich protein-like [Dendrobium catenatum] gb|PKU83611.1| hypothetical protein MA16_Dca019838 [Dendrobium catenatum] Length = 205 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/42 (57%), Positives = 29/42 (69%) Frame = -3 Query: 223 FQEDVILPSLPNIDNMTNEEKLLIRSKYKLEHFWLGSCYHLE 98 F EDV LP + I+N +NEEK+LI K K E FW SCY+LE Sbjct: 30 FPEDVKLPDVSKIENFSNEEKVLINWKIKFERFWKTSCYYLE 71