BLASTX nr result
ID: Ophiopogon26_contig00020309
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00020309 (425 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020247367.1| ras-related protein RABC1 isoform X2 [Aspara... 68 2e-11 ref|XP_020247366.1| ras-related protein RABC1 isoform X1 [Aspara... 68 3e-11 ref|XP_009349739.1| PREDICTED: ras-related protein RABC1-like, p... 56 5e-07 ref|XP_019190369.1| PREDICTED: ras-related protein RABC1-like [I... 57 5e-07 ref|XP_009371394.1| PREDICTED: ras-related protein RABC1-like [P... 57 5e-07 ref|XP_009349005.1| PREDICTED: ras-related protein RABC1-like [P... 56 6e-07 ref|XP_009374211.1| PREDICTED: ras-related protein RABC1-like [P... 56 1e-06 gb|PON40734.1| hypothetical protein PanWU01x14_295270 [Parasponi... 52 3e-06 ref|XP_018857120.1| PREDICTED: probable protein phosphatase 2C 1... 55 5e-06 ref|XP_007212052.1| ras-related protein RABC1 [Prunus persica] >... 54 7e-06 ref|XP_023919040.1| ras-related protein RABC1-like [Quercus sube... 54 8e-06 ref|XP_010680212.1| PREDICTED: ras-related protein RABC1 [Beta v... 54 9e-06 ref|XP_010911541.1| PREDICTED: ras-related protein RABC1 [Elaeis... 54 9e-06 ref|XP_008778565.2| PREDICTED: ras-related protein RABC1, partia... 52 1e-05 ref|XP_023923987.1| ras-related protein RABC1-like [Quercus sube... 54 1e-05 >ref|XP_020247367.1| ras-related protein RABC1 isoform X2 [Asparagus officinalis] Length = 189 Score = 68.2 bits (165), Expect = 2e-11 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = +3 Query: 3 DTPSLLAEGSASVKKKNIFKQTQPQADAAESGCC 104 DTPSLLAEGSASVKKKNIFKQ+QPQADAA SGCC Sbjct: 156 DTPSLLAEGSASVKKKNIFKQSQPQADAATSGCC 189 >ref|XP_020247366.1| ras-related protein RABC1 isoform X1 [Asparagus officinalis] gb|ONK56709.1| uncharacterized protein A4U43_C10F11920 [Asparagus officinalis] Length = 211 Score = 68.2 bits (165), Expect = 3e-11 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = +3 Query: 3 DTPSLLAEGSASVKKKNIFKQTQPQADAAESGCC 104 DTPSLLAEGSASVKKKNIFKQ+QPQADAA SGCC Sbjct: 178 DTPSLLAEGSASVKKKNIFKQSQPQADAATSGCC 211 >ref|XP_009349739.1| PREDICTED: ras-related protein RABC1-like, partial [Pyrus x bretschneideri] Length = 160 Score = 56.2 bits (134), Expect = 5e-07 Identities = 25/34 (73%), Positives = 28/34 (82%) Frame = +3 Query: 3 DTPSLLAEGSASVKKKNIFKQTQPQADAAESGCC 104 DTPSLLAEGS VKK NIFK+ PQ+DA+ SGCC Sbjct: 127 DTPSLLAEGSKGVKKNNIFKEKPPQSDASTSGCC 160 >ref|XP_019190369.1| PREDICTED: ras-related protein RABC1-like [Ipomoea nil] ref|XP_019190370.1| PREDICTED: ras-related protein RABC1-like [Ipomoea nil] Length = 213 Score = 57.0 bits (136), Expect = 5e-07 Identities = 25/34 (73%), Positives = 29/34 (85%) Frame = +3 Query: 3 DTPSLLAEGSASVKKKNIFKQTQPQADAAESGCC 104 DTPSLL+EGSASVK+ NIFKQ P+ DA+ SGCC Sbjct: 180 DTPSLLSEGSASVKRSNIFKQKPPETDASASGCC 213 >ref|XP_009371394.1| PREDICTED: ras-related protein RABC1-like [Pyrus x bretschneideri] ref|XP_018506255.1| PREDICTED: ras-related protein RABC1-like [Pyrus x bretschneideri] Length = 213 Score = 57.0 bits (136), Expect = 5e-07 Identities = 26/34 (76%), Positives = 28/34 (82%) Frame = +3 Query: 3 DTPSLLAEGSASVKKKNIFKQTQPQADAAESGCC 104 DTPSLLAEGS VKK NIFK+ PQADA+ SGCC Sbjct: 180 DTPSLLAEGSKGVKKNNIFKEKLPQADASTSGCC 213 >ref|XP_009349005.1| PREDICTED: ras-related protein RABC1-like [Pyrus x bretschneideri] Length = 170 Score = 56.2 bits (134), Expect = 6e-07 Identities = 25/34 (73%), Positives = 28/34 (82%) Frame = +3 Query: 3 DTPSLLAEGSASVKKKNIFKQTQPQADAAESGCC 104 DTPSLLAEGS VKK NIFK+ PQ+DA+ SGCC Sbjct: 137 DTPSLLAEGSKGVKKNNIFKEKPPQSDASTSGCC 170 >ref|XP_009374211.1| PREDICTED: ras-related protein RABC1-like [Pyrus x bretschneideri] Length = 213 Score = 56.2 bits (134), Expect = 1e-06 Identities = 25/34 (73%), Positives = 28/34 (82%) Frame = +3 Query: 3 DTPSLLAEGSASVKKKNIFKQTQPQADAAESGCC 104 DTPSLLAEGS VKK NIFK+ PQ+DA+ SGCC Sbjct: 180 DTPSLLAEGSKGVKKNNIFKEKPPQSDASTSGCC 213 >gb|PON40734.1| hypothetical protein PanWU01x14_295270 [Parasponia andersonii] Length = 71 Score = 52.0 bits (123), Expect = 3e-06 Identities = 25/34 (73%), Positives = 29/34 (85%) Frame = +3 Query: 3 DTPSLLAEGSASVKKKNIFKQTQPQADAAESGCC 104 +TPSLLAEGSA VKK NIFK+ PQ+DA+ SGCC Sbjct: 37 ETPSLLAEGSAGVKK-NIFKEKPPQSDASTSGCC 69 >ref|XP_018857120.1| PREDICTED: probable protein phosphatase 2C 11 [Juglans regia] Length = 540 Score = 55.1 bits (131), Expect = 5e-06 Identities = 25/34 (73%), Positives = 28/34 (82%) Frame = +3 Query: 3 DTPSLLAEGSASVKKKNIFKQTQPQADAAESGCC 104 +TPSLLAEGSA VKK NIFKQ PQ+ A+ SGCC Sbjct: 179 ETPSLLAEGSAGVKKSNIFKQKPPQSGASTSGCC 212 >ref|XP_007212052.1| ras-related protein RABC1 [Prunus persica] ref|XP_021819116.1| ras-related protein RABC1 [Prunus avium] gb|ONI14261.1| hypothetical protein PRUPE_4G271600 [Prunus persica] gb|ONI14262.1| hypothetical protein PRUPE_4G271600 [Prunus persica] Length = 210 Score = 53.9 bits (128), Expect = 7e-06 Identities = 24/34 (70%), Positives = 27/34 (79%) Frame = +3 Query: 3 DTPSLLAEGSASVKKKNIFKQTQPQADAAESGCC 104 DTPSLLAEGS VKK NIFK+ PQ+DA+ S CC Sbjct: 177 DTPSLLAEGSKGVKKNNIFKEKPPQSDASTSSCC 210 >ref|XP_023919040.1| ras-related protein RABC1-like [Quercus suber] gb|POF02083.1| ras-related protein rabc1 [Quercus suber] Length = 202 Score = 53.5 bits (127), Expect = 8e-06 Identities = 26/34 (76%), Positives = 29/34 (85%) Frame = +3 Query: 3 DTPSLLAEGSASVKKKNIFKQTQPQADAAESGCC 104 DTPSLLAEGSA VKK NIFK+ PQ+DA+ SGCC Sbjct: 168 DTPSLLAEGSAGVKK-NIFKEIPPQSDASTSGCC 200 >ref|XP_010680212.1| PREDICTED: ras-related protein RABC1 [Beta vulgaris subsp. vulgaris] gb|KMT09164.1| hypothetical protein BVRB_6g132690 [Beta vulgaris subsp. vulgaris] Length = 207 Score = 53.5 bits (127), Expect = 9e-06 Identities = 27/34 (79%), Positives = 28/34 (82%) Frame = +3 Query: 3 DTPSLLAEGSASVKKKNIFKQTQPQADAAESGCC 104 DTPSLLAEGSA KKNIFKQ PQADA+ SGCC Sbjct: 175 DTPSLLAEGSAG-GKKNIFKQKPPQADASASGCC 207 >ref|XP_010911541.1| PREDICTED: ras-related protein RABC1 [Elaeis guineensis] Length = 210 Score = 53.5 bits (127), Expect = 9e-06 Identities = 27/34 (79%), Positives = 28/34 (82%) Frame = +3 Query: 3 DTPSLLAEGSASVKKKNIFKQTQPQADAAESGCC 104 DTPSLLAEGSA VKK NIFKQ PQADA+ S CC Sbjct: 178 DTPSLLAEGSAGVKK-NIFKQKPPQADASTSSCC 210 >ref|XP_008778565.2| PREDICTED: ras-related protein RABC1, partial [Phoenix dactylifera] Length = 140 Score = 52.4 bits (124), Expect = 1e-05 Identities = 26/34 (76%), Positives = 28/34 (82%) Frame = +3 Query: 3 DTPSLLAEGSASVKKKNIFKQTQPQADAAESGCC 104 DTPSLLAEGSA VK+ NIFKQ PQADA+ S CC Sbjct: 108 DTPSLLAEGSAGVKR-NIFKQKPPQADASTSSCC 140 >ref|XP_023923987.1| ras-related protein RABC1-like [Quercus suber] gb|POF24782.1| ras-related protein rabc1 [Quercus suber] Length = 216 Score = 53.5 bits (127), Expect = 1e-05 Identities = 26/34 (76%), Positives = 29/34 (85%) Frame = +3 Query: 3 DTPSLLAEGSASVKKKNIFKQTQPQADAAESGCC 104 DTPSLLAEGSA VKK NIFK+ PQ+DA+ SGCC Sbjct: 182 DTPSLLAEGSAGVKK-NIFKEIPPQSDASTSGCC 214