BLASTX nr result
ID: Ophiopogon26_contig00020286
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00020286 (1071 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020270402.1| uncharacterized protein ycf45 [Asparagus off... 85 3e-14 >ref|XP_020270402.1| uncharacterized protein ycf45 [Asparagus officinalis] gb|ONK66745.1| uncharacterized protein A4U43_C06F11510 [Asparagus officinalis] Length = 630 Score = 84.7 bits (208), Expect = 3e-14 Identities = 40/56 (71%), Positives = 47/56 (83%) Frame = +1 Query: 4 KWEKVGREPQFSLCIHPIPLDVEDNMSSDQVVDTESDLEDIFSLDDMNSSQNGVSR 171 KWEKVGREP FSLCI P+PLD ++ QVVDT S+LED+FSLDDM+SSQNGV+R Sbjct: 569 KWEKVGREPHFSLCILPLPLDTKEKGPLYQVVDTGSELEDMFSLDDMSSSQNGVAR 624