BLASTX nr result
ID: Ophiopogon26_contig00013328
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00013328 (704 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020241051.1| uncharacterized protein LOC109819657 [Aspara... 64 1e-08 >ref|XP_020241051.1| uncharacterized protein LOC109819657 [Asparagus officinalis] gb|ONK59868.1| uncharacterized protein A4U43_C08F11790 [Asparagus officinalis] Length = 194 Score = 63.5 bits (153), Expect = 1e-08 Identities = 31/46 (67%), Positives = 34/46 (73%) Frame = -1 Query: 245 GCQSGWTMYLDHSYGSRAVSMQQHQQQDYNXXXXXEDLSMVSDASS 108 GCQSGWTMY + SY S+A+SMQ HQ QD EDLSMVSDASS Sbjct: 24 GCQSGWTMYFEKSYESKAISMQYHQLQDEEEEEEEEDLSMVSDASS 69