BLASTX nr result
ID: Ophiopogon26_contig00011440
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00011440 (479 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020088355.1| peptide-N4-(N-acetyl-beta-glucosaminyl)aspar... 58 8e-07 ref|XP_008789985.1| PREDICTED: peptide-N4-(N-acetyl-beta-glucosa... 56 4e-06 ref|XP_009421268.2| PREDICTED: peptide-N4-(N-acetyl-beta-glucosa... 56 4e-06 ref|XP_020576767.1| LOW QUALITY PROTEIN: peptide-N4-(N-acetyl-be... 56 5e-06 ref|XP_008811312.1| PREDICTED: LOW QUALITY PROTEIN: peptide-N4-(... 55 7e-06 ref|XP_010925634.1| PREDICTED: peptide-N4-(N-acetyl-beta-glucosa... 55 7e-06 gb|PKA51654.1| Peptide-N4-(N-acetyl-beta-glucosaminyl)asparagine... 55 9e-06 ref|XP_010915505.1| PREDICTED: peptide-N4-(N-acetyl-beta-glucosa... 55 9e-06 >ref|XP_020088355.1| peptide-N4-(N-acetyl-beta-glucosaminyl)asparagine amidase A-like, partial [Ananas comosus] Length = 595 Score = 58.2 bits (139), Expect = 8e-07 Identities = 31/45 (68%), Positives = 33/45 (73%), Gaps = 4/45 (8%) Frame = -2 Query: 124 SASSSTLRC--RHLRH--PSLAVLEWSAACTGRQFDRIFGVWLSG 2 +AS + RC RHLR P AVLEWSAAC GRQFDRIFGVWL G Sbjct: 67 TASYAPPRCLRRHLRRRSPVRAVLEWSAACRGRQFDRIFGVWLGG 111 >ref|XP_008789985.1| PREDICTED: peptide-N4-(N-acetyl-beta-glucosaminyl)asparagine amidase A-like [Phoenix dactylifera] Length = 610 Score = 56.2 bits (134), Expect = 4e-06 Identities = 25/33 (75%), Positives = 25/33 (75%) Frame = -2 Query: 100 CRHLRHPSLAVLEWSAACTGRQFDRIFGVWLSG 2 C R PS VLEWSAAC GRQFDRIFGVWL G Sbjct: 87 CPFHRPPSAVVLEWSAACRGRQFDRIFGVWLDG 119 >ref|XP_009421268.2| PREDICTED: peptide-N4-(N-acetyl-beta-glucosaminyl)asparagine amidase A-like [Musa acuminata subsp. malaccensis] Length = 648 Score = 56.2 bits (134), Expect = 4e-06 Identities = 26/34 (76%), Positives = 26/34 (76%) Frame = -2 Query: 103 RCRHLRHPSLAVLEWSAACTGRQFDRIFGVWLSG 2 R R R PS AVLEWSA C GRQFDRIFGVWL G Sbjct: 143 RLRRGRVPSRAVLEWSATCQGRQFDRIFGVWLGG 176 >ref|XP_020576767.1| LOW QUALITY PROTEIN: peptide-N4-(N-acetyl-beta-glucosaminyl)asparagine amidase A-like [Phalaenopsis equestris] Length = 1045 Score = 55.8 bits (133), Expect = 5e-06 Identities = 23/29 (79%), Positives = 26/29 (89%) Frame = -2 Query: 88 RHPSLAVLEWSAACTGRQFDRIFGVWLSG 2 R PSL +L+WSAAC GRQFDRIFGVWL+G Sbjct: 99 RPPSLIILQWSAACAGRQFDRIFGVWLAG 127 >ref|XP_008811312.1| PREDICTED: LOW QUALITY PROTEIN: peptide-N4-(N-acetyl-beta-glucosaminyl)asparagine amidase A-like [Phoenix dactylifera] Length = 596 Score = 55.5 bits (132), Expect = 7e-06 Identities = 25/33 (75%), Positives = 25/33 (75%) Frame = -2 Query: 100 CRHLRHPSLAVLEWSAACTGRQFDRIFGVWLSG 2 C R PS VLEWSAAC GRQFDRIFGVWL G Sbjct: 95 CPLHRPPSAVVLEWSAACRGRQFDRIFGVWLGG 127 >ref|XP_010925634.1| PREDICTED: peptide-N4-(N-acetyl-beta-glucosaminyl)asparagine amidase A [Elaeis guineensis] Length = 616 Score = 55.5 bits (132), Expect = 7e-06 Identities = 25/33 (75%), Positives = 25/33 (75%) Frame = -2 Query: 100 CRHLRHPSLAVLEWSAACTGRQFDRIFGVWLSG 2 C R PS VLEWSAAC GRQFDRIFGVWL G Sbjct: 92 CPLHRPPSAVVLEWSAACRGRQFDRIFGVWLGG 124 >gb|PKA51654.1| Peptide-N4-(N-acetyl-beta-glucosaminyl)asparagine amidase A [Apostasia shenzhenica] Length = 604 Score = 55.1 bits (131), Expect = 9e-06 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = -2 Query: 88 RHPSLAVLEWSAACTGRQFDRIFGVWLSG 2 R PS VLEWSAAC GRQFDRIFGVWL+G Sbjct: 105 RAPSRIVLEWSAACAGRQFDRIFGVWLAG 133 >ref|XP_010915505.1| PREDICTED: peptide-N4-(N-acetyl-beta-glucosaminyl)asparagine amidase A-like [Elaeis guineensis] Length = 611 Score = 55.1 bits (131), Expect = 9e-06 Identities = 24/29 (82%), Positives = 24/29 (82%) Frame = -2 Query: 88 RHPSLAVLEWSAACTGRQFDRIFGVWLSG 2 R PS VLEWSAAC GRQFDRIFGVWL G Sbjct: 91 RPPSAVVLEWSAACRGRQFDRIFGVWLDG 119