BLASTX nr result
ID: Ophiopogon26_contig00011339
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00011339 (464 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020266613.1| glycosyltransferase-like At2g41451 [Asparagu... 64 7e-09 ref|XP_010924548.1| PREDICTED: glycosyltransferase-like At2g4145... 56 3e-06 >ref|XP_020266613.1| glycosyltransferase-like At2g41451 [Asparagus officinalis] Length = 750 Score = 63.9 bits (154), Expect = 7e-09 Identities = 33/56 (58%), Positives = 42/56 (75%), Gaps = 4/56 (7%) Frame = -3 Query: 456 LPNSIAGESANTQKIASSKE----SHATNRKILEFSDIFEKALPPMSPPGLDDHHM 301 LP+ +S++T A++KE SHA NRKILEFSDIFEKA+PP+SPPGLD H+ Sbjct: 695 LPSMEEKKSSDTAGSANTKEDSTVSHAINRKILEFSDIFEKAVPPISPPGLDSVHL 750 >ref|XP_010924548.1| PREDICTED: glycosyltransferase-like At2g41451 [Elaeis guineensis] Length = 529 Score = 56.2 bits (134), Expect = 3e-06 Identities = 28/51 (54%), Positives = 34/51 (66%) Frame = -3 Query: 462 SVLPNSIAGESANTQKIASSKESHATNRKILEFSDIFEKALPPMSPPGLDD 310 S LPN S NT + A KES+A+ RKILE + E A+PP+SPPGLDD Sbjct: 478 SALPNLSTAASKNTMRGAGGKESYASARKILETAVFTENAIPPISPPGLDD 528