BLASTX nr result
ID: Ophiopogon26_contig00010163
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00010163 (362 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020672116.1| pentatricopeptide repeat-containing protein ... 56 1e-06 ref|XP_020245916.1| pentatricopeptide repeat-containing protein ... 54 5e-06 >ref|XP_020672116.1| pentatricopeptide repeat-containing protein At5g14080 [Dendrobium catenatum] gb|PKU66882.1| Pentatricopeptide repeat-containing protein [Dendrobium catenatum] Length = 660 Score = 56.2 bits (134), Expect = 1e-06 Identities = 25/50 (50%), Positives = 38/50 (76%) Frame = +1 Query: 211 NKGNYIVASTIMYGLSCKV*GDSSDFILIKSLTDAGEVDMAIKHMKRIQN 360 ++GNY+ AS +M+G+ K+ SD IL+KSL DAGE+DMA KH++ ++N Sbjct: 558 SEGNYVYASHVMHGVPDKIESCDSDIILLKSLADAGEMDMAAKHVEWVKN 607 >ref|XP_020245916.1| pentatricopeptide repeat-containing protein At5g14080 [Asparagus officinalis] ref|XP_020245917.1| pentatricopeptide repeat-containing protein At5g14080 [Asparagus officinalis] ref|XP_020245918.1| pentatricopeptide repeat-containing protein At5g14080 [Asparagus officinalis] ref|XP_020245919.1| pentatricopeptide repeat-containing protein At5g14080 [Asparagus officinalis] ref|XP_020245920.1| pentatricopeptide repeat-containing protein At5g14080 [Asparagus officinalis] ref|XP_020245922.1| pentatricopeptide repeat-containing protein At5g14080 [Asparagus officinalis] ref|XP_020245923.1| pentatricopeptide repeat-containing protein At5g14080 [Asparagus officinalis] ref|XP_020245924.1| pentatricopeptide repeat-containing protein At5g14080 [Asparagus officinalis] ref|XP_020245925.1| pentatricopeptide repeat-containing protein At5g14080 [Asparagus officinalis] ref|XP_020245926.1| pentatricopeptide repeat-containing protein At5g14080 [Asparagus officinalis] gb|ONK58541.1| uncharacterized protein A4U43_C09F14130 [Asparagus officinalis] Length = 585 Score = 54.3 bits (129), Expect = 5e-06 Identities = 25/48 (52%), Positives = 35/48 (72%) Frame = +1 Query: 214 KGNYIVASTIMYGLSCKV*GDSSDFILIKSLTDAGEVDMAIKHMKRIQ 357 + NYI AS +M+GL + S IL+KSLTDAGE++MA++HMK I+ Sbjct: 477 EANYIEASNVMHGLPSNIEDSGSHVILLKSLTDAGEIEMAVEHMKWIK 524