BLASTX nr result
ID: Ophiopogon26_contig00010124
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00010124 (425 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020259852.1| guanine nucleotide-binding protein-like NSN1... 62 3e-08 ref|XP_010917988.1| PREDICTED: guanine nucleotide-binding protei... 58 5e-07 ref|XP_008798499.1| PREDICTED: guanine nucleotide-binding protei... 56 2e-06 >ref|XP_020259852.1| guanine nucleotide-binding protein-like NSN1 [Asparagus officinalis] gb|ONK70770.1| uncharacterized protein A4U43_C04F1350 [Asparagus officinalis] Length = 583 Score = 61.6 bits (148), Expect = 3e-08 Identities = 32/53 (60%), Positives = 38/53 (71%), Gaps = 3/53 (5%) Frame = -1 Query: 386 QNLLNQMDADYDFKVDFHMKDAPSDVNTAREED-DSDGNANED--MASVEMDA 237 +N NQMDADYDFKVD+ MKD+ SDVNT E+D D D E+ MA VE+DA Sbjct: 531 KNSANQMDADYDFKVDYQMKDSTSDVNTVDEDDKDGDNETTEEAPMAGVEIDA 583 >ref|XP_010917988.1| PREDICTED: guanine nucleotide-binding protein-like NSN1 [Elaeis guineensis] Length = 596 Score = 58.2 bits (139), Expect = 5e-07 Identities = 32/53 (60%), Positives = 40/53 (75%), Gaps = 4/53 (7%) Frame = -1 Query: 383 NLLNQMDADYDFKVDFHMKDAPSDVNTAREEDDSDG--NANED--MASVEMDA 237 NL+N MDADYDFKVD+HM + SD+N A ED SDG +ANE+ M+ VE+DA Sbjct: 545 NLMNDMDADYDFKVDYHMGEVGSDLNAA-GEDQSDGADDANEEVPMSGVEVDA 596 >ref|XP_008798499.1| PREDICTED: guanine nucleotide-binding protein-like NSN1 [Phoenix dactylifera] Length = 596 Score = 56.2 bits (134), Expect = 2e-06 Identities = 29/52 (55%), Positives = 38/52 (73%), Gaps = 3/52 (5%) Frame = -1 Query: 383 NLLNQMDADYDFKVDFHMKDAPSDVNTARE-EDDSDGNANED--MASVEMDA 237 NL+N MDADYDFKVD+ M++ SDVN A E E D + +ANE+ M+ V +DA Sbjct: 545 NLMNDMDADYDFKVDYQMREVGSDVNAAGEDESDGEDDANEEVPMSGVGVDA 596