BLASTX nr result
ID: Ophiopogon26_contig00008380
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00008380 (450 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI26194.3| unnamed protein product, partial [Vitis vinifera] 56 3e-07 pdb|5G49|B Chain B, Crystal Structure Of The Arabodopsis Thalian... 55 3e-07 gb|PNX89913.1| nuclear transcription factor Y subunit C-9-like p... 56 4e-07 ref|XP_001784527.1| predicted protein [Physcomitrella patens] 56 4e-07 gb|ONK79465.1| uncharacterized protein A4U43_C01F6640 [Asparagus... 56 5e-07 ref|XP_002969604.1| hypothetical protein SELMODRAFT_69579, parti... 55 5e-07 ref|XP_022854944.1| nuclear transcription factor Y subunit C-1-l... 56 6e-07 ref|XP_002981952.1| hypothetical protein SELMODRAFT_58662, parti... 56 6e-07 ref|XP_001761875.1| predicted protein [Physcomitrella patens] 56 6e-07 gb|KVI08490.1| Histone-fold [Cynara cardunculus var. scolymus] 56 7e-07 dbj|BAN89464.1| nuclear factor Y, subunit C1 [Shorea beccariana] 56 7e-07 gb|AEX12571.1| hypothetical protein 2_4892_01, partial [Pinus ta... 56 7e-07 emb|CAA74054.1| Transcription factor, partial [Arabidopsis thali... 56 7e-07 gb|PPS04730.1| hypothetical protein GOBAR_AA15920 [Gossypium bar... 56 8e-07 ref|XP_024022347.1| nuclear transcription factor Y subunit C-1-l... 56 9e-07 gb|PPD89169.1| hypothetical protein GOBAR_DD13891 [Gossypium bar... 56 1e-06 dbj|GAV74256.1| CBFD_NFYB_HMF domain-containing protein [Cephalo... 57 1e-06 ref|XP_024022349.1| nuclear transcription factor Y subunit C-1-l... 56 1e-06 ref|XP_020690331.1| nuclear transcription factor Y subunit C-4-l... 56 1e-06 gb|KHG10756.1| Nuclear transcription factor Y subunit C-9 -like ... 56 1e-06 >emb|CBI26194.3| unnamed protein product, partial [Vitis vinifera] Length = 104 Score = 55.8 bits (133), Expect = 3e-07 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -3 Query: 448 RTLQKNDIAAAITRTDIFDFLVDIVPR 368 RTLQKNDIAAAITRTDIFDFLVDIVPR Sbjct: 10 RTLQKNDIAAAITRTDIFDFLVDIVPR 36 >pdb|5G49|B Chain B, Crystal Structure Of The Arabodopsis Thaliana Histone-fold Dimer L1l Nf-yc3 Length = 95 Score = 55.5 bits (132), Expect = 3e-07 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = -3 Query: 448 RTLQKNDIAAAITRTDIFDFLVDIVPR 368 RTLQKNDIAAA+TRTDIFDFLVDIVPR Sbjct: 69 RTLQKNDIAAAVTRTDIFDFLVDIVPR 95 >gb|PNX89913.1| nuclear transcription factor Y subunit C-9-like protein, partial [Trifolium pratense] Length = 123 Score = 55.8 bits (133), Expect = 4e-07 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -3 Query: 448 RTLQKNDIAAAITRTDIFDFLVDIVPR 368 RTLQKNDIAAAITRTDIFDFLVDIVPR Sbjct: 16 RTLQKNDIAAAITRTDIFDFLVDIVPR 42 >ref|XP_001784527.1| predicted protein [Physcomitrella patens] Length = 127 Score = 55.8 bits (133), Expect = 4e-07 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -3 Query: 448 RTLQKNDIAAAITRTDIFDFLVDIVPR 368 RTLQKNDIAAAITRTDIFDFLVDIVPR Sbjct: 58 RTLQKNDIAAAITRTDIFDFLVDIVPR 84 >gb|ONK79465.1| uncharacterized protein A4U43_C01F6640 [Asparagus officinalis] Length = 131 Score = 55.8 bits (133), Expect = 5e-07 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -3 Query: 448 RTLQKNDIAAAITRTDIFDFLVDIVPR 368 RTLQKNDIAAAITRTDIFDFLVDIVPR Sbjct: 43 RTLQKNDIAAAITRTDIFDFLVDIVPR 69 >ref|XP_002969604.1| hypothetical protein SELMODRAFT_69579, partial [Selaginella moellendorffii] ref|XP_002970872.1| hypothetical protein SELMODRAFT_69578, partial [Selaginella moellendorffii] gb|EFJ28198.1| hypothetical protein SELMODRAFT_69578, partial [Selaginella moellendorffii] gb|EFJ29692.1| hypothetical protein SELMODRAFT_69579, partial [Selaginella moellendorffii] Length = 116 Score = 55.5 bits (132), Expect = 5e-07 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = -3 Query: 448 RTLQKNDIAAAITRTDIFDFLVDIVPR 368 RTLQKNDIAAA+TRTDIFDFLVDIVPR Sbjct: 66 RTLQKNDIAAAVTRTDIFDFLVDIVPR 92 >ref|XP_022854944.1| nuclear transcription factor Y subunit C-1-like, partial [Olea europaea var. sylvestris] Length = 143 Score = 55.8 bits (133), Expect = 6e-07 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -3 Query: 448 RTLQKNDIAAAITRTDIFDFLVDIVPR 368 RTLQKNDIAAAITRTDIFDFLVDIVPR Sbjct: 109 RTLQKNDIAAAITRTDIFDFLVDIVPR 135 >ref|XP_002981952.1| hypothetical protein SELMODRAFT_58662, partial [Selaginella moellendorffii] ref|XP_002982931.1| hypothetical protein SELMODRAFT_58661, partial [Selaginella moellendorffii] gb|EFJ16176.1| hypothetical protein SELMODRAFT_58661, partial [Selaginella moellendorffii] gb|EFJ17045.1| hypothetical protein SELMODRAFT_58662, partial [Selaginella moellendorffii] Length = 147 Score = 55.8 bits (133), Expect = 6e-07 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -3 Query: 448 RTLQKNDIAAAITRTDIFDFLVDIVPR 368 RTLQKNDIAAAITRTDIFDFLVDIVPR Sbjct: 85 RTLQKNDIAAAITRTDIFDFLVDIVPR 111 >ref|XP_001761875.1| predicted protein [Physcomitrella patens] Length = 147 Score = 55.8 bits (133), Expect = 6e-07 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -3 Query: 448 RTLQKNDIAAAITRTDIFDFLVDIVPR 368 RTLQKNDIAAAITRTDIFDFLVDIVPR Sbjct: 62 RTLQKNDIAAAITRTDIFDFLVDIVPR 88 >gb|KVI08490.1| Histone-fold [Cynara cardunculus var. scolymus] Length = 150 Score = 55.8 bits (133), Expect = 7e-07 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -3 Query: 448 RTLQKNDIAAAITRTDIFDFLVDIVPR 368 RTLQKNDIAAAITRTDIFDFLVDIVPR Sbjct: 43 RTLQKNDIAAAITRTDIFDFLVDIVPR 69 >dbj|BAN89464.1| nuclear factor Y, subunit C1 [Shorea beccariana] Length = 150 Score = 55.8 bits (133), Expect = 7e-07 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -3 Query: 448 RTLQKNDIAAAITRTDIFDFLVDIVPR 368 RTLQKNDIAAAITRTDIFDFLVDIVPR Sbjct: 43 RTLQKNDIAAAITRTDIFDFLVDIVPR 69 >gb|AEX12571.1| hypothetical protein 2_4892_01, partial [Pinus taeda] gb|AEX12572.1| hypothetical protein 2_4892_01, partial [Pinus taeda] gb|AEX12573.1| hypothetical protein 2_4892_01, partial [Pinus taeda] gb|AEX12574.1| hypothetical protein 2_4892_01, partial [Pinus taeda] gb|AEX12575.1| hypothetical protein 2_4892_01, partial [Pinus radiata] gb|AEX12576.1| hypothetical protein 2_4892_01, partial [Pinus lambertiana] Length = 154 Score = 55.8 bits (133), Expect = 7e-07 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -3 Query: 448 RTLQKNDIAAAITRTDIFDFLVDIVPR 368 RTLQKNDIAAAITRTDIFDFLVDIVPR Sbjct: 83 RTLQKNDIAAAITRTDIFDFLVDIVPR 109 >emb|CAA74054.1| Transcription factor, partial [Arabidopsis thaliana] Length = 155 Score = 55.8 bits (133), Expect = 7e-07 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -3 Query: 448 RTLQKNDIAAAITRTDIFDFLVDIVPR 368 RTLQKNDIAAAITRTDIFDFLVDIVPR Sbjct: 38 RTLQKNDIAAAITRTDIFDFLVDIVPR 64 >gb|PPS04730.1| hypothetical protein GOBAR_AA15920 [Gossypium barbadense] Length = 162 Score = 55.8 bits (133), Expect = 8e-07 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -3 Query: 448 RTLQKNDIAAAITRTDIFDFLVDIVPR 368 RTLQKNDIAAAITRTDIFDFLVDIVPR Sbjct: 56 RTLQKNDIAAAITRTDIFDFLVDIVPR 82 >ref|XP_024022347.1| nuclear transcription factor Y subunit C-1-like, partial [Morus notabilis] Length = 169 Score = 55.8 bits (133), Expect = 9e-07 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -3 Query: 448 RTLQKNDIAAAITRTDIFDFLVDIVPR 368 RTLQKNDIAAAITRTDIFDFLVDIVPR Sbjct: 123 RTLQKNDIAAAITRTDIFDFLVDIVPR 149 >gb|PPD89169.1| hypothetical protein GOBAR_DD13891 [Gossypium barbadense] Length = 174 Score = 55.8 bits (133), Expect = 1e-06 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -3 Query: 448 RTLQKNDIAAAITRTDIFDFLVDIVPR 368 RTLQKNDIAAAITRTDIFDFLVDIVPR Sbjct: 68 RTLQKNDIAAAITRTDIFDFLVDIVPR 94 >dbj|GAV74256.1| CBFD_NFYB_HMF domain-containing protein [Cephalotus follicularis] Length = 230 Score = 56.6 bits (135), Expect = 1e-06 Identities = 33/68 (48%), Positives = 38/68 (55%) Frame = -3 Query: 448 RTLQKNDIAAAITRTDIFDFLVDIVPRXXXXXXXXXXXXILXXXXXXXXXXXXXXXXGSG 269 RTLQKNDIAAAITRTDIFDFLVDIVPR + SG Sbjct: 119 RTLQKNDIAAAITRTDIFDFLVDIVPRDEIKDESALGGIVGATASGVPYYYPPMGQPASG 178 Query: 268 VMMGQPAI 245 +M+G+PA+ Sbjct: 179 MMIGRPAM 186 >ref|XP_024022349.1| nuclear transcription factor Y subunit C-1-like isoform X2 [Morus notabilis] Length = 181 Score = 55.8 bits (133), Expect = 1e-06 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -3 Query: 448 RTLQKNDIAAAITRTDIFDFLVDIVPR 368 RTLQKNDIAAAITRTDIFDFLVDIVPR Sbjct: 72 RTLQKNDIAAAITRTDIFDFLVDIVPR 98 >ref|XP_020690331.1| nuclear transcription factor Y subunit C-4-like isoform X2 [Dendrobium catenatum] Length = 183 Score = 55.8 bits (133), Expect = 1e-06 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -3 Query: 448 RTLQKNDIAAAITRTDIFDFLVDIVPR 368 RTLQKNDIAAAITRTDIFDFLVDIVPR Sbjct: 72 RTLQKNDIAAAITRTDIFDFLVDIVPR 98 >gb|KHG10756.1| Nuclear transcription factor Y subunit C-9 -like protein [Gossypium arboreum] Length = 187 Score = 55.8 bits (133), Expect = 1e-06 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -3 Query: 448 RTLQKNDIAAAITRTDIFDFLVDIVPR 368 RTLQKNDIAAAITRTDIFDFLVDIVPR Sbjct: 74 RTLQKNDIAAAITRTDIFDFLVDIVPR 100