BLASTX nr result
ID: Ophiopogon26_contig00008343
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00008343 (499 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020260966.1| oleoyl-acyl carrier protein thioesterase 1, ... 85 1e-17 ref|XP_009411854.1| PREDICTED: oleoyl-acyl carrier protein thioe... 84 5e-17 ref|XP_009411855.1| PREDICTED: oleoyl-acyl carrier protein thioe... 84 5e-17 emb|CBI35766.3| unnamed protein product, partial [Vitis vinifera] 82 9e-17 gb|AAL77443.1|L78467_1 acyl-ACP thioesterase [Iris tectorum] 82 1e-16 ref|XP_020106065.1| oleoyl-acyl carrier protein thioesterase, ch... 82 2e-16 gb|ALB76803.1| acyl-ACP thioesterase, partial [Jatropha curcas] 81 3e-16 ref|XP_008794587.1| PREDICTED: oleoyl-acyl carrier protein thioe... 81 3e-16 ref|XP_008794588.1| PREDICTED: oleoyl-acyl carrier protein thioe... 81 3e-16 ref|XP_010927699.1| PREDICTED: oleoyl-acyl carrier protein thioe... 81 3e-16 ref|XP_010926746.1| PREDICTED: oleoyl-acyl carrier protein thioe... 81 3e-16 ref|XP_020683927.1| oleoyl-acyl carrier protein thioesterase, ch... 81 6e-16 ref|XP_023755065.1| oleoyl-acyl carrier protein thioesterase, ch... 84 8e-16 ref|XP_008802240.1| PREDICTED: oleoyl-acyl carrier protein thioe... 79 9e-16 gb|PKA47430.1| Oleoyl-acyl carrier protein thioesterase 2, chlor... 82 1e-15 gb|AAD28187.1| oleoyl-ACP thioesterase, partial [Elaeis guineensis] 81 1e-15 emb|CBI40881.3| unnamed protein product, partial [Vitis vinifera] 82 2e-15 gb|AAZ83073.1| oleoyl-ACP thioesterase, partial [Elaeis oleifera] 79 2e-15 ref|NP_001292940.1| oleoyl-acyl carrier protein thioesterase 1, ... 81 3e-15 ref|XP_020589501.1| oleoyl-acyl carrier protein thioesterase 1, ... 80 3e-15 >ref|XP_020260966.1| oleoyl-acyl carrier protein thioesterase 1, chloroplastic-like [Asparagus officinalis] gb|ONK71906.1| uncharacterized protein A4U43_C04F13590 [Asparagus officinalis] Length = 369 Score = 85.1 bits (209), Expect(2) = 1e-17 Identities = 40/43 (93%), Positives = 40/43 (93%) Frame = -1 Query: 427 WFLESMPQEIIDTHELQTITLDYRRECQHDDTVDSLTSSELAG 299 W LESMPQEIIDTHELQTITLDYRRECQHDD VDSLTS ELAG Sbjct: 275 WVLESMPQEIIDTHELQTITLDYRRECQHDDMVDSLTSLELAG 317 Score = 32.0 bits (71), Expect(2) = 1e-17 Identities = 14/17 (82%), Positives = 14/17 (82%) Frame = -2 Query: 240 SRLEINRGHTEWRKLAR 190 S LEINRG TEWRKL R Sbjct: 353 SGLEINRGRTEWRKLRR 369 >ref|XP_009411854.1| PREDICTED: oleoyl-acyl carrier protein thioesterase 1, chloroplastic isoform X1 [Musa acuminata subsp. malaccensis] Length = 391 Score = 84.0 bits (206), Expect(2) = 5e-17 Identities = 39/42 (92%), Positives = 39/42 (92%) Frame = -1 Query: 427 WFLESMPQEIIDTHELQTITLDYRRECQHDDTVDSLTSSELA 302 W LESMPQEIIDTHELQTITLDYRRECQHDD VDSLTSSE A Sbjct: 304 WVLESMPQEIIDTHELQTITLDYRRECQHDDAVDSLTSSEFA 345 Score = 31.2 bits (69), Expect(2) = 5e-17 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -2 Query: 234 LEINRGHTEWRKLAR 190 LEINRG TEWRKL R Sbjct: 377 LEINRGRTEWRKLIR 391 >ref|XP_009411855.1| PREDICTED: oleoyl-acyl carrier protein thioesterase 1, chloroplastic isoform X2 [Musa acuminata subsp. malaccensis] Length = 365 Score = 84.0 bits (206), Expect(2) = 5e-17 Identities = 39/42 (92%), Positives = 39/42 (92%) Frame = -1 Query: 427 WFLESMPQEIIDTHELQTITLDYRRECQHDDTVDSLTSSELA 302 W LESMPQEIIDTHELQTITLDYRRECQHDD VDSLTSSE A Sbjct: 278 WVLESMPQEIIDTHELQTITLDYRRECQHDDAVDSLTSSEFA 319 Score = 31.2 bits (69), Expect(2) = 5e-17 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -2 Query: 234 LEINRGHTEWRKLAR 190 LEINRG TEWRKL R Sbjct: 351 LEINRGRTEWRKLIR 365 >emb|CBI35766.3| unnamed protein product, partial [Vitis vinifera] Length = 144 Score = 82.0 bits (201), Expect = 9e-17 Identities = 38/40 (95%), Positives = 38/40 (95%) Frame = -1 Query: 427 WFLESMPQEIIDTHELQTITLDYRRECQHDDTVDSLTSSE 308 W LESMPQEIIDTHELQTITLDYRRECQHDD VDSLTSSE Sbjct: 49 WVLESMPQEIIDTHELQTITLDYRRECQHDDIVDSLTSSE 88 >gb|AAL77443.1|L78467_1 acyl-ACP thioesterase [Iris tectorum] Length = 371 Score = 82.4 bits (202), Expect(2) = 1e-16 Identities = 38/43 (88%), Positives = 39/43 (90%) Frame = -1 Query: 427 WFLESMPQEIIDTHELQTITLDYRRECQHDDTVDSLTSSELAG 299 W LESMPQEIIDTHELQTITLDYRRECQHDD VDSLTS E+ G Sbjct: 274 WVLESMPQEIIDTHELQTITLDYRRECQHDDLVDSLTSLEVVG 316 Score = 31.2 bits (69), Expect(2) = 1e-16 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -2 Query: 234 LEINRGHTEWRKLAR 190 LEINRG TEWRKL R Sbjct: 354 LEINRGRTEWRKLIR 368 >ref|XP_020106065.1| oleoyl-acyl carrier protein thioesterase, chloroplastic-like [Ananas comosus] Length = 290 Score = 81.6 bits (200), Expect(2) = 2e-16 Identities = 38/41 (92%), Positives = 38/41 (92%) Frame = -1 Query: 427 WFLESMPQEIIDTHELQTITLDYRRECQHDDTVDSLTSSEL 305 W LESMPQEIIDTHELQTITLDYRRECQHDD VDSLTS EL Sbjct: 202 WVLESMPQEIIDTHELQTITLDYRRECQHDDVVDSLTSLEL 242 Score = 31.6 bits (70), Expect(2) = 2e-16 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -2 Query: 234 LEINRGHTEWRKLAR 190 LEINRG TEWRKL R Sbjct: 276 LEINRGRTEWRKLVR 290 >gb|ALB76803.1| acyl-ACP thioesterase, partial [Jatropha curcas] Length = 167 Score = 81.3 bits (199), Expect = 3e-16 Identities = 37/40 (92%), Positives = 38/40 (95%) Frame = -1 Query: 427 WFLESMPQEIIDTHELQTITLDYRRECQHDDTVDSLTSSE 308 W LESMPQEIIDTHELQTITLDYRRECQHDD VDSLTS+E Sbjct: 74 WVLESMPQEIIDTHELQTITLDYRRECQHDDVVDSLTSAE 113 >ref|XP_008794587.1| PREDICTED: oleoyl-acyl carrier protein thioesterase, chloroplastic-like isoform X1 [Phoenix dactylifera] Length = 390 Score = 81.3 bits (199), Expect(2) = 3e-16 Identities = 38/42 (90%), Positives = 39/42 (92%) Frame = -1 Query: 427 WFLESMPQEIIDTHELQTITLDYRRECQHDDTVDSLTSSELA 302 W LESMPQEIIDTHELQTITLDYRRECQH+D VDSLTS ELA Sbjct: 303 WVLESMPQEIIDTHELQTITLDYRRECQHNDVVDSLTSLELA 344 Score = 31.2 bits (69), Expect(2) = 3e-16 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -2 Query: 234 LEINRGHTEWRKLAR 190 LEINRG TEWRKL R Sbjct: 376 LEINRGRTEWRKLIR 390 >ref|XP_008794588.1| PREDICTED: oleoyl-acyl carrier protein thioesterase, chloroplastic-like isoform X2 [Phoenix dactylifera] Length = 365 Score = 81.3 bits (199), Expect(2) = 3e-16 Identities = 38/42 (90%), Positives = 39/42 (92%) Frame = -1 Query: 427 WFLESMPQEIIDTHELQTITLDYRRECQHDDTVDSLTSSELA 302 W LESMPQEIIDTHELQTITLDYRRECQH+D VDSLTS ELA Sbjct: 278 WVLESMPQEIIDTHELQTITLDYRRECQHNDVVDSLTSLELA 319 Score = 31.2 bits (69), Expect(2) = 3e-16 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -2 Query: 234 LEINRGHTEWRKLAR 190 LEINRG TEWRKL R Sbjct: 351 LEINRGRTEWRKLIR 365 >ref|XP_010927699.1| PREDICTED: oleoyl-acyl carrier protein thioesterase 1, chloroplastic [Elaeis guineensis] Length = 362 Score = 80.9 bits (198), Expect(2) = 3e-16 Identities = 38/42 (90%), Positives = 39/42 (92%) Frame = -1 Query: 427 WFLESMPQEIIDTHELQTITLDYRRECQHDDTVDSLTSSELA 302 W LESMPQEIIDTHELQTITLDYRRECQH+D VDSLTS ELA Sbjct: 275 WVLESMPQEIIDTHELQTITLDYRRECQHNDMVDSLTSLELA 316 Score = 31.6 bits (70), Expect(2) = 3e-16 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -2 Query: 234 LEINRGHTEWRKLAR 190 LEINRG TEWRKL R Sbjct: 348 LEINRGRTEWRKLVR 362 >ref|XP_010926746.1| PREDICTED: oleoyl-acyl carrier protein thioesterase, chloroplastic [Elaeis guineensis] Length = 360 Score = 80.9 bits (198), Expect(2) = 3e-16 Identities = 38/42 (90%), Positives = 39/42 (92%) Frame = -1 Query: 427 WFLESMPQEIIDTHELQTITLDYRRECQHDDTVDSLTSSELA 302 W LESMPQEIIDTHELQTITLDYRRECQH+D VDSLTS ELA Sbjct: 273 WVLESMPQEIIDTHELQTITLDYRRECQHNDMVDSLTSLELA 314 Score = 31.6 bits (70), Expect(2) = 3e-16 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -2 Query: 234 LEINRGHTEWRKLAR 190 LEINRG TEWRKL R Sbjct: 346 LEINRGRTEWRKLVR 360 >ref|XP_020683927.1| oleoyl-acyl carrier protein thioesterase, chloroplastic-like [Dendrobium catenatum] Length = 179 Score = 80.9 bits (198), Expect = 6e-16 Identities = 37/40 (92%), Positives = 38/40 (95%) Frame = -1 Query: 427 WFLESMPQEIIDTHELQTITLDYRRECQHDDTVDSLTSSE 308 W LESMPQEIIDTHEL+TITLDYRRECQHDD VDSLTSSE Sbjct: 88 WVLESMPQEIIDTHELETITLDYRRECQHDDMVDSLTSSE 127 >ref|XP_023755065.1| oleoyl-acyl carrier protein thioesterase, chloroplastic [Lactuca sativa] gb|PLY92057.1| hypothetical protein LSAT_5X180701 [Lactuca sativa] Length = 372 Score = 83.6 bits (205), Expect = 8e-16 Identities = 38/43 (88%), Positives = 40/43 (93%) Frame = -1 Query: 427 WFLESMPQEIIDTHELQTITLDYRRECQHDDTVDSLTSSELAG 299 W LES+PQE+IDTHELQTITLDYRRECQHDD VDSLTSSEL G Sbjct: 289 WVLESIPQEVIDTHELQTITLDYRRECQHDDIVDSLTSSELEG 331 >ref|XP_008802240.1| PREDICTED: oleoyl-acyl carrier protein thioesterase, chloroplastic-like [Phoenix dactylifera] Length = 360 Score = 79.3 bits (194), Expect(2) = 9e-16 Identities = 37/41 (90%), Positives = 38/41 (92%) Frame = -1 Query: 427 WFLESMPQEIIDTHELQTITLDYRRECQHDDTVDSLTSSEL 305 W LESMPQEIIDTHELQTITLDYRRECQH+D VDSLTS EL Sbjct: 273 WVLESMPQEIIDTHELQTITLDYRRECQHNDMVDSLTSLEL 313 Score = 31.6 bits (70), Expect(2) = 9e-16 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -2 Query: 234 LEINRGHTEWRKLAR 190 LEINRG TEWRKL R Sbjct: 346 LEINRGRTEWRKLVR 360 >gb|PKA47430.1| Oleoyl-acyl carrier protein thioesterase 2, chloroplastic [Apostasia shenzhenica] Length = 369 Score = 82.4 bits (202), Expect(2) = 1e-15 Identities = 38/40 (95%), Positives = 38/40 (95%) Frame = -1 Query: 427 WFLESMPQEIIDTHELQTITLDYRRECQHDDTVDSLTSSE 308 W LESMPQEIIDTHELQTITLDYRRECQHDD VDSLTSSE Sbjct: 278 WLLESMPQEIIDTHELQTITLDYRRECQHDDMVDSLTSSE 317 Score = 28.1 bits (61), Expect(2) = 1e-15 Identities = 12/15 (80%), Positives = 12/15 (80%) Frame = -2 Query: 234 LEINRGHTEWRKLAR 190 LEINRG T WRKL R Sbjct: 355 LEINRGRTIWRKLIR 369 >gb|AAD28187.1| oleoyl-ACP thioesterase, partial [Elaeis guineensis] Length = 222 Score = 80.9 bits (198), Expect = 1e-15 Identities = 38/42 (90%), Positives = 39/42 (92%) Frame = -1 Query: 427 WFLESMPQEIIDTHELQTITLDYRRECQHDDTVDSLTSSELA 302 W LESMPQEIIDTHELQTITLDYRRECQH+D VDSLTS ELA Sbjct: 149 WVLESMPQEIIDTHELQTITLDYRRECQHNDMVDSLTSLELA 190 >emb|CBI40881.3| unnamed protein product, partial [Vitis vinifera] Length = 297 Score = 82.0 bits (201), Expect = 2e-15 Identities = 38/40 (95%), Positives = 38/40 (95%) Frame = -1 Query: 427 WFLESMPQEIIDTHELQTITLDYRRECQHDDTVDSLTSSE 308 W LESMPQEIIDTHELQTITLDYRRECQHDD VDSLTSSE Sbjct: 202 WVLESMPQEIIDTHELQTITLDYRRECQHDDIVDSLTSSE 241 >gb|AAZ83073.1| oleoyl-ACP thioesterase, partial [Elaeis oleifera] Length = 168 Score = 79.3 bits (194), Expect = 2e-15 Identities = 38/42 (90%), Positives = 38/42 (90%) Frame = -1 Query: 427 WFLESMPQEIIDTHELQTITLDYRRECQHDDTVDSLTSSELA 302 W LESMPQEIIDTHELQTITLDYRRECQH D VDSLTS ELA Sbjct: 95 WVLESMPQEIIDTHELQTITLDYRRECQHYDMVDSLTSLELA 136 >ref|NP_001292940.1| oleoyl-acyl carrier protein thioesterase 1, chloroplastic [Jatropha curcas] gb|ABX82799.3| acyl-ACP thioesterase [Jatropha curcas] gb|KDP26359.1| hypothetical protein JCGZ_17517 [Jatropha curcas] gb|AJE63434.1| acyl-ACP thioesterase [Jatropha curcas] Length = 369 Score = 81.3 bits (199), Expect(2) = 3e-15 Identities = 37/40 (92%), Positives = 38/40 (95%) Frame = -1 Query: 427 WFLESMPQEIIDTHELQTITLDYRRECQHDDTVDSLTSSE 308 W LESMPQEIIDTHELQTITLDYRRECQHDD VDSLTS+E Sbjct: 276 WVLESMPQEIIDTHELQTITLDYRRECQHDDVVDSLTSAE 315 Score = 28.1 bits (61), Expect(2) = 3e-15 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -2 Query: 234 LEINRGHTEWRK 199 LEINRG TEWRK Sbjct: 354 LEINRGRTEWRK 365 >ref|XP_020589501.1| oleoyl-acyl carrier protein thioesterase 1, chloroplastic-like [Phalaenopsis equestris] Length = 367 Score = 80.5 bits (197), Expect(2) = 3e-15 Identities = 37/39 (94%), Positives = 37/39 (94%) Frame = -1 Query: 427 WFLESMPQEIIDTHELQTITLDYRRECQHDDTVDSLTSS 311 W LESMPQEIIDTHELQTITLDYRRECQHDD VDSLTSS Sbjct: 275 WVLESMPQEIIDTHELQTITLDYRRECQHDDVVDSLTSS 313 Score = 28.5 bits (62), Expect(2) = 3e-15 Identities = 12/15 (80%), Positives = 12/15 (80%) Frame = -2 Query: 234 LEINRGHTEWRKLAR 190 LEINRG T WRKL R Sbjct: 353 LEINRGRTVWRKLIR 367