BLASTX nr result
ID: Ophiopogon26_contig00008014
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon26_contig00008014 (404 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK65169.1| uncharacterized protein A4U43_C07F34400 [Asparagu... 62 1e-09 ref|XP_020241940.1| uncharacterized protein At1g01500-like [Aspa... 64 2e-09 gb|KHN18812.1| Hypothetical protein glysoja_045332 [Glycine soja] 60 3e-09 ref|XP_020114805.1| uncharacterized protein At1g01500 [Ananas co... 63 5e-09 gb|OAY78817.1| Uncharacterized protein ACMD2_11399 [Ananas comosus] 63 5e-09 gb|OAY65064.1| Uncharacterized protein ACMD2_18882 [Ananas comosus] 63 6e-09 gb|KHN26928.1| Hypothetical protein glysoja_031005 [Glycine soja] 60 6e-09 ref|XP_020246340.1| LOW QUALITY PROTEIN: uncharacterized protein... 63 6e-09 gb|PNX73657.1| c-terminal binding protein an-like, partial [Trif... 58 1e-08 gb|PNY06302.1| c-terminal binding protein an-like, partial [Trif... 58 1e-08 ref|XP_020595725.1| uncharacterized protein At1g01500-like [Phal... 59 2e-08 ref|XP_020581849.1| uncharacterized protein At1g01500-like [Phal... 59 2e-08 ref|XP_009399456.1| PREDICTED: uncharacterized protein At1g01500... 61 3e-08 gb|OMO64409.1| hypothetical protein CCACVL1_21790 [Corchorus cap... 61 3e-08 gb|OIW04854.1| hypothetical protein TanjilG_13694 [Lupinus angus... 57 3e-08 ref|XP_009405372.1| PREDICTED: uncharacterized protein At1g01500... 61 4e-08 ref|XP_008797172.1| PREDICTED: uncharacterized protein At1g01500... 61 4e-08 ref|XP_010934633.1| PREDICTED: LOW QUALITY PROTEIN: uncharacteri... 61 4e-08 gb|KZV57653.1| hypothetical protein F511_03113 [Dorcoceras hygro... 60 4e-08 gb|KDP28566.1| hypothetical protein JCGZ_14337 [Jatropha curcas] 60 4e-08 >gb|ONK65169.1| uncharacterized protein A4U43_C07F34400 [Asparagus officinalis] Length = 117 Score = 61.6 bits (148), Expect = 1e-09 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 3 LGMCVGLGIGVGLLMRSYQATTRSFKRRFF 92 LGMCVGLGIGVGLLM SYQATTRSFKRRFF Sbjct: 88 LGMCVGLGIGVGLLMSSYQATTRSFKRRFF 117 >ref|XP_020241940.1| uncharacterized protein At1g01500-like [Asparagus officinalis] gb|ONK59084.1| uncharacterized protein A4U43_C08F2810 [Asparagus officinalis] Length = 286 Score = 63.9 bits (154), Expect = 2e-09 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +3 Query: 3 LGMCVGLGIGVGLLMRSYQATTRSFKRRFF 92 LGMCVGLGIGVGLLMRSYQATTRSFKRRFF Sbjct: 257 LGMCVGLGIGVGLLMRSYQATTRSFKRRFF 286 >gb|KHN18812.1| Hypothetical protein glysoja_045332 [Glycine soja] Length = 95 Score = 60.1 bits (144), Expect = 3e-09 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +3 Query: 3 LGMCVGLGIGVGLLMRSYQATTRSFKRRFF 92 LGMCVGLGIGVGLLMRSYQ TTR+F+RRFF Sbjct: 66 LGMCVGLGIGVGLLMRSYQTTTRNFRRRFF 95 >ref|XP_020114805.1| uncharacterized protein At1g01500 [Ananas comosus] Length = 331 Score = 63.2 bits (152), Expect = 5e-09 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = +3 Query: 3 LGMCVGLGIGVGLLMRSYQATTRSFKRRFF 92 LGMCVG+GIGVGLLMRSYQATTRSFKRRFF Sbjct: 302 LGMCVGIGIGVGLLMRSYQATTRSFKRRFF 331 >gb|OAY78817.1| Uncharacterized protein ACMD2_11399 [Ananas comosus] Length = 331 Score = 63.2 bits (152), Expect = 5e-09 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = +3 Query: 3 LGMCVGLGIGVGLLMRSYQATTRSFKRRFF 92 LGMCVG+GIGVGLLMRSYQATTRSFKRRFF Sbjct: 302 LGMCVGIGIGVGLLMRSYQATTRSFKRRFF 331 >gb|OAY65064.1| Uncharacterized protein ACMD2_18882 [Ananas comosus] Length = 341 Score = 63.2 bits (152), Expect = 6e-09 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = +3 Query: 3 LGMCVGLGIGVGLLMRSYQATTRSFKRRFF 92 LGMCVG+GIGVGLLMRSYQATTRSFKRRFF Sbjct: 312 LGMCVGIGIGVGLLMRSYQATTRSFKRRFF 341 >gb|KHN26928.1| Hypothetical protein glysoja_031005 [Glycine soja] Length = 116 Score = 60.1 bits (144), Expect = 6e-09 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +3 Query: 3 LGMCVGLGIGVGLLMRSYQATTRSFKRRFF 92 LGMCVGLGIGVGLLMRSYQ TTR+F+RRFF Sbjct: 87 LGMCVGLGIGVGLLMRSYQTTTRNFRRRFF 116 >ref|XP_020246340.1| LOW QUALITY PROTEIN: uncharacterized protein At1g01500-like [Asparagus officinalis] Length = 286 Score = 62.8 bits (151), Expect = 6e-09 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = +3 Query: 3 LGMCVGLGIGVGLLMRSYQATTRSFKRRFF 92 LGMCVG+GIGVGLLMRSYQATTRSFKRRFF Sbjct: 257 LGMCVGVGIGVGLLMRSYQATTRSFKRRFF 286 >gb|PNX73657.1| c-terminal binding protein an-like, partial [Trifolium pratense] Length = 79 Score = 58.2 bits (139), Expect = 1e-08 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = +3 Query: 3 LGMCVGLGIGVGLLMRSYQATTRSFKRRFF 92 LGMCVG+GIGVGLLMRSYQ TTR+F+R+FF Sbjct: 50 LGMCVGIGIGVGLLMRSYQTTTRNFRRKFF 79 >gb|PNY06302.1| c-terminal binding protein an-like, partial [Trifolium pratense] Length = 84 Score = 58.2 bits (139), Expect = 1e-08 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = +3 Query: 3 LGMCVGLGIGVGLLMRSYQATTRSFKRRFF 92 LGMCVG+GIGVGLLMRSYQ TTR+F+R+FF Sbjct: 55 LGMCVGIGIGVGLLMRSYQTTTRNFRRKFF 84 >ref|XP_020595725.1| uncharacterized protein At1g01500-like [Phalaenopsis equestris] Length = 137 Score = 58.9 bits (141), Expect = 2e-08 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = +3 Query: 3 LGMCVGLGIGVGLLMRSYQATTRSFKRRFF 92 LGMC+G+GIG GLL+RSYQATTRSF+RRFF Sbjct: 108 LGMCIGIGIGAGLLLRSYQATTRSFRRRFF 137 >ref|XP_020581849.1| uncharacterized protein At1g01500-like [Phalaenopsis equestris] Length = 137 Score = 58.9 bits (141), Expect = 2e-08 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = +3 Query: 3 LGMCVGLGIGVGLLMRSYQATTRSFKRRFF 92 LGMC+G+GIG GLL+RSYQATTRSF+RRFF Sbjct: 108 LGMCIGIGIGAGLLLRSYQATTRSFRRRFF 137 >ref|XP_009399456.1| PREDICTED: uncharacterized protein At1g01500-like [Musa acuminata subsp. malaccensis] Length = 344 Score = 61.2 bits (147), Expect = 3e-08 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +3 Query: 3 LGMCVGLGIGVGLLMRSYQATTRSFKRRFF 92 LGMCVG+GIGVGLLM SYQATTRSFKRRFF Sbjct: 315 LGMCVGIGIGVGLLMNSYQATTRSFKRRFF 344 >gb|OMO64409.1| hypothetical protein CCACVL1_21790 [Corchorus capsularis] Length = 299 Score = 60.8 bits (146), Expect = 3e-08 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = +3 Query: 3 LGMCVGLGIGVGLLMRSYQATTRSFKRRFF 92 LGMCVG+GIGVGLLMRSYQATTR+F+RRFF Sbjct: 270 LGMCVGIGIGVGLLMRSYQATTRNFRRRFF 299 >gb|OIW04854.1| hypothetical protein TanjilG_13694 [Lupinus angustifolius] Length = 62 Score = 56.6 bits (135), Expect = 3e-08 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = +3 Query: 3 LGMCVGLGIGVGLLMRSYQATTRSFKRRFF 92 LGMC+G+G+GVGLLMRSYQ TTR+ KRRFF Sbjct: 33 LGMCLGIGVGVGLLMRSYQTTTRNLKRRFF 62 >ref|XP_009405372.1| PREDICTED: uncharacterized protein At1g01500-like [Musa acuminata subsp. malaccensis] Length = 340 Score = 60.8 bits (146), Expect = 4e-08 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +3 Query: 3 LGMCVGLGIGVGLLMRSYQATTRSFKRRFF 92 LGMCVG+GIGVGLLM SYQATTRSFKRRFF Sbjct: 311 LGMCVGIGIGVGLLMSSYQATTRSFKRRFF 340 >ref|XP_008797172.1| PREDICTED: uncharacterized protein At1g01500-like [Phoenix dactylifera] Length = 346 Score = 60.8 bits (146), Expect = 4e-08 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = +3 Query: 3 LGMCVGLGIGVGLLMRSYQATTRSFKRRFF 92 LGMCVG+GIGVGLLMRSYQATTR+F+RRFF Sbjct: 317 LGMCVGIGIGVGLLMRSYQATTRNFRRRFF 346 >ref|XP_010934633.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein At1g01500-like [Elaeis guineensis] Length = 348 Score = 60.8 bits (146), Expect = 4e-08 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = +3 Query: 3 LGMCVGLGIGVGLLMRSYQATTRSFKRRFF 92 LGMCVG+GIGVGLLMRSYQATTR+F+RRFF Sbjct: 319 LGMCVGIGIGVGLLMRSYQATTRNFRRRFF 348 >gb|KZV57653.1| hypothetical protein F511_03113 [Dorcoceras hygrometricum] Length = 295 Score = 60.5 bits (145), Expect = 4e-08 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = +3 Query: 3 LGMCVGLGIGVGLLMRSYQATTRSFKRRFF 92 LGMC+G+GIGVGLLMRSYQATTRSF+RRFF Sbjct: 266 LGMCLGVGIGVGLLMRSYQATTRSFRRRFF 295 >gb|KDP28566.1| hypothetical protein JCGZ_14337 [Jatropha curcas] Length = 301 Score = 60.5 bits (145), Expect = 4e-08 Identities = 26/30 (86%), Positives = 30/30 (100%) Frame = +3 Query: 3 LGMCVGLGIGVGLLMRSYQATTRSFKRRFF 92 LGMC+G+GIGVGLLMRSYQATTR+F+RRFF Sbjct: 272 LGMCIGIGIGVGLLMRSYQATTRNFRRRFF 301