BLASTX nr result
ID: Ophiopogon24_contig00024202
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00024202 (580 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020261424.1| uncharacterized protein LOC109837541 [Aspara... 58 2e-06 >ref|XP_020261424.1| uncharacterized protein LOC109837541 [Asparagus officinalis] gb|ONK72347.1| uncharacterized protein A4U43_C04F18460 [Asparagus officinalis] Length = 404 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/45 (60%), Positives = 27/45 (60%) Frame = +3 Query: 3 HYPSPGNVDNGLLRFYLTPXXXXXXXXXXXXXXXXXFFPKGILGH 137 HYPSPGNVDNGLLRFYLTP FFP GILGH Sbjct: 360 HYPSPGNVDNGLLRFYLTPMRTSRRSSNNRRMPSSRFFPMGILGH 404