BLASTX nr result
ID: Ophiopogon24_contig00012847
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00012847 (801 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008785212.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 119 1e-26 ref|XP_010925250.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 119 1e-26 ref|XP_010914921.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 114 7e-25 ref|XP_010914920.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 114 8e-25 ref|XP_020251273.1| peptidyl-prolyl cis-trans isomerase CYP95-li... 113 1e-24 ref|XP_009419289.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 112 3e-24 ref|XP_020087995.1| peptidyl-prolyl cis-trans isomerase CYP95 [A... 112 4e-24 ref|XP_021275810.1| peptidyl-prolyl cis-trans isomerase CYP95 is... 111 5e-24 ref|XP_021275807.1| peptidyl-prolyl cis-trans isomerase CYP95 is... 111 5e-24 ref|XP_021275806.1| peptidyl-prolyl cis-trans isomerase CYP95 is... 111 5e-24 ref|XP_021275805.1| peptidyl-prolyl cis-trans isomerase CYP95 is... 111 5e-24 ref|XP_009381127.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 110 1e-23 gb|OVA00494.1| Cyclophilin-like peptidyl-prolyl cis-trans isomer... 109 2e-23 dbj|GAV70565.1| Pro_isomerase domain-containing protein [Cephalo... 109 3e-23 ref|XP_010546571.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 108 4e-23 ref|XP_010546569.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 108 4e-23 gb|EOY31440.1| Peptidyl-prolyl cis-trans isomerase CYP19-2 isofo... 108 4e-23 gb|EOY31437.1| Peptidyl-prolyl cis-trans isomerase CYP19-2 isofo... 108 5e-23 ref|XP_017983288.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 108 5e-23 gb|EOY31436.1| Peptidyl-prolyl cis-trans isomerase CYP19-2 isofo... 108 6e-23 >ref|XP_008785212.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like [Phoenix dactylifera] ref|XP_017697447.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95-like [Phoenix dactylifera] Length = 818 Score = 119 bits (298), Expect = 1e-26 Identities = 67/128 (52%), Positives = 70/128 (54%), Gaps = 6/128 (4%) Frame = +2 Query: 431 ALSPPSNRGRSLSRSASPDGSPKRIRRGRGFSQRYSYARRYRTPSPDRSPVRSHRYGGXX 610 ALSPPSN GRSLSRS SPDGSPKRIRRGRGFS +YSYARRYRTPSPDRSPVRSHRYGG Sbjct: 606 ALSPPSNHGRSLSRSTSPDGSPKRIRRGRGFSDKYSYARRYRTPSPDRSPVRSHRYGGRG 665 Query: 611 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIGYRGR------RS 772 +GYRGR RS Sbjct: 666 DRDRYSSYRSFRDRTPPRRYRSPPRGRTPPRYRSRRSRTRSISRSPVGYRGRAKGGYSRS 725 Query: 773 PVRSRTPV 796 P RSR+PV Sbjct: 726 PARSRSPV 733 >ref|XP_010925250.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 [Elaeis guineensis] ref|XP_010925251.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 [Elaeis guineensis] ref|XP_010925252.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 [Elaeis guineensis] Length = 842 Score = 119 bits (298), Expect = 1e-26 Identities = 67/127 (52%), Positives = 70/127 (55%), Gaps = 6/127 (4%) Frame = +2 Query: 431 ALSPPSNRGRSLSRSASPDGSPKRIRRGRGFSQRYSYARRYRTPSPDRSPVRSHRYGGXX 610 ALSPPSN GRSLSRSASPDGSPKRIRRGRGFS +YSYARRYRTPSPDRSPVRSHRYGG Sbjct: 630 ALSPPSNHGRSLSRSASPDGSPKRIRRGRGFSDKYSYARRYRTPSPDRSPVRSHRYGGRG 689 Query: 611 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIGYRGR------RS 772 +GYRGR RS Sbjct: 690 DRDRYSSYRSFRDRTPPRRYRSPPRGRTPTRYRSRRSRTRSISRSPVGYRGRAKGGYSRS 749 Query: 773 PVRSRTP 793 P RSR+P Sbjct: 750 PARSRSP 756 >ref|XP_010914921.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform X2 [Elaeis guineensis] Length = 726 Score = 114 bits (284), Expect = 7e-25 Identities = 64/127 (50%), Positives = 68/127 (53%), Gaps = 6/127 (4%) Frame = +2 Query: 431 ALSPPSNRGRSLSRSASPDGSPKRIRRGRGFSQRYSYARRYRTPSPDRSPVRSHRYGGXX 610 A+SPPSN RSLSRS SPDGSPKRIRRGRGFS +YSYARRYRTPSPDRSPVRSHRYGG Sbjct: 516 AISPPSNHNRSLSRSVSPDGSPKRIRRGRGFSDKYSYARRYRTPSPDRSPVRSHRYGGRG 575 Query: 611 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIGYRGR------RS 772 +GYRGR RS Sbjct: 576 DRDRYSSYRSFRDRTPPRRYRSPPRGRTPTRYRSRRSRTRSISRSPVGYRGRGKGGYNRS 635 Query: 773 PVRSRTP 793 P RSR+P Sbjct: 636 PSRSRSP 642 >ref|XP_010914920.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform X1 [Elaeis guineensis] Length = 836 Score = 114 bits (284), Expect = 8e-25 Identities = 64/127 (50%), Positives = 68/127 (53%), Gaps = 6/127 (4%) Frame = +2 Query: 431 ALSPPSNRGRSLSRSASPDGSPKRIRRGRGFSQRYSYARRYRTPSPDRSPVRSHRYGGXX 610 A+SPPSN RSLSRS SPDGSPKRIRRGRGFS +YSYARRYRTPSPDRSPVRSHRYGG Sbjct: 626 AISPPSNHNRSLSRSVSPDGSPKRIRRGRGFSDKYSYARRYRTPSPDRSPVRSHRYGGRG 685 Query: 611 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIGYRGR------RS 772 +GYRGR RS Sbjct: 686 DRDRYSSYRSFRDRTPPRRYRSPPRGRTPTRYRSRRSRTRSISRSPVGYRGRGKGGYNRS 745 Query: 773 PVRSRTP 793 P RSR+P Sbjct: 746 PSRSRSP 752 >ref|XP_020251273.1| peptidyl-prolyl cis-trans isomerase CYP95-like [Asparagus officinalis] gb|ONK81011.1| uncharacterized protein A4U43_C01F24280 [Asparagus officinalis] Length = 823 Score = 113 bits (282), Expect = 1e-24 Identities = 52/58 (89%), Positives = 56/58 (96%) Frame = +2 Query: 431 ALSPPSNRGRSLSRSASPDGSPKRIRRGRGFSQRYSYARRYRTPSPDRSPVRSHRYGG 604 ALSPPSNRGRS SRSASPDGSPKRI+RGRGFS++YSYARRYRT SPDRSP+RSHRYGG Sbjct: 628 ALSPPSNRGRSFSRSASPDGSPKRIQRGRGFSEKYSYARRYRTRSPDRSPIRSHRYGG 685 >ref|XP_009419289.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 [Musa acuminata subsp. malaccensis] Length = 819 Score = 112 bits (280), Expect = 3e-24 Identities = 52/58 (89%), Positives = 55/58 (94%) Frame = +2 Query: 431 ALSPPSNRGRSLSRSASPDGSPKRIRRGRGFSQRYSYARRYRTPSPDRSPVRSHRYGG 604 A+SPPSN RSLSRSASPDGSPKRIRRGRGFSQ+YSYARRYRTPSPDRSP+R HRYGG Sbjct: 613 AISPPSNHRRSLSRSASPDGSPKRIRRGRGFSQQYSYARRYRTPSPDRSPIRLHRYGG 670 >ref|XP_020087995.1| peptidyl-prolyl cis-trans isomerase CYP95 [Ananas comosus] ref|XP_020087996.1| peptidyl-prolyl cis-trans isomerase CYP95 [Ananas comosus] gb|OAY82935.1| Peptidyl-prolyl cis-trans isomerase CYP63 [Ananas comosus] Length = 826 Score = 112 bits (279), Expect = 4e-24 Identities = 52/58 (89%), Positives = 56/58 (96%) Frame = +2 Query: 431 ALSPPSNRGRSLSRSASPDGSPKRIRRGRGFSQRYSYARRYRTPSPDRSPVRSHRYGG 604 A+SPP NRGRSLSRS SPDGSPKRIRRGRGFSQRYSYARRYRTPSP+RSPVRS+R+GG Sbjct: 619 AVSPPVNRGRSLSRSGSPDGSPKRIRRGRGFSQRYSYARRYRTPSPERSPVRSYRFGG 676 >ref|XP_021275810.1| peptidyl-prolyl cis-trans isomerase CYP95 isoform X4 [Herrania umbratica] ref|XP_021275811.1| peptidyl-prolyl cis-trans isomerase CYP95 isoform X4 [Herrania umbratica] Length = 723 Score = 111 bits (278), Expect = 5e-24 Identities = 52/56 (92%), Positives = 54/56 (96%) Frame = +2 Query: 437 SPPSNRGRSLSRSASPDGSPKRIRRGRGFSQRYSYARRYRTPSPDRSPVRSHRYGG 604 SPPSNRGRSLSRS SPD SPKRIRRGRGFS+RYSYARRYRTPSPDRSPVRS+RYGG Sbjct: 526 SPPSNRGRSLSRSISPDASPKRIRRGRGFSERYSYARRYRTPSPDRSPVRSYRYGG 581 >ref|XP_021275807.1| peptidyl-prolyl cis-trans isomerase CYP95 isoform X3 [Herrania umbratica] ref|XP_021275808.1| peptidyl-prolyl cis-trans isomerase CYP95 isoform X3 [Herrania umbratica] ref|XP_021275809.1| peptidyl-prolyl cis-trans isomerase CYP95 isoform X3 [Herrania umbratica] Length = 833 Score = 111 bits (278), Expect = 5e-24 Identities = 52/56 (92%), Positives = 54/56 (96%) Frame = +2 Query: 437 SPPSNRGRSLSRSASPDGSPKRIRRGRGFSQRYSYARRYRTPSPDRSPVRSHRYGG 604 SPPSNRGRSLSRS SPD SPKRIRRGRGFS+RYSYARRYRTPSPDRSPVRS+RYGG Sbjct: 636 SPPSNRGRSLSRSISPDASPKRIRRGRGFSERYSYARRYRTPSPDRSPVRSYRYGG 691 >ref|XP_021275806.1| peptidyl-prolyl cis-trans isomerase CYP95 isoform X2 [Herrania umbratica] Length = 843 Score = 111 bits (278), Expect = 5e-24 Identities = 52/56 (92%), Positives = 54/56 (96%) Frame = +2 Query: 437 SPPSNRGRSLSRSASPDGSPKRIRRGRGFSQRYSYARRYRTPSPDRSPVRSHRYGG 604 SPPSNRGRSLSRS SPD SPKRIRRGRGFS+RYSYARRYRTPSPDRSPVRS+RYGG Sbjct: 646 SPPSNRGRSLSRSISPDASPKRIRRGRGFSERYSYARRYRTPSPDRSPVRSYRYGG 701 >ref|XP_021275805.1| peptidyl-prolyl cis-trans isomerase CYP95 isoform X1 [Herrania umbratica] Length = 848 Score = 111 bits (278), Expect = 5e-24 Identities = 52/56 (92%), Positives = 54/56 (96%) Frame = +2 Query: 437 SPPSNRGRSLSRSASPDGSPKRIRRGRGFSQRYSYARRYRTPSPDRSPVRSHRYGG 604 SPPSNRGRSLSRS SPD SPKRIRRGRGFS+RYSYARRYRTPSPDRSPVRS+RYGG Sbjct: 651 SPPSNRGRSLSRSISPDASPKRIRRGRGFSERYSYARRYRTPSPDRSPVRSYRYGG 706 >ref|XP_009381127.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 [Musa acuminata subsp. malaccensis] Length = 832 Score = 110 bits (275), Expect = 1e-23 Identities = 52/58 (89%), Positives = 54/58 (93%) Frame = +2 Query: 431 ALSPPSNRGRSLSRSASPDGSPKRIRRGRGFSQRYSYARRYRTPSPDRSPVRSHRYGG 604 A SPPSNR RSLSRS SPDGSPKRIRRGRGFSQ+YS+ARRYRTPSPDRSPVR HRYGG Sbjct: 610 AASPPSNRRRSLSRSVSPDGSPKRIRRGRGFSQQYSFARRYRTPSPDRSPVRLHRYGG 667 >gb|OVA00494.1| Cyclophilin-like peptidyl-prolyl cis-trans isomerase domain [Macleaya cordata] Length = 811 Score = 109 bits (273), Expect = 2e-23 Identities = 54/57 (94%), Positives = 55/57 (96%), Gaps = 1/57 (1%) Frame = +2 Query: 437 SPPSN-RGRSLSRSASPDGSPKRIRRGRGFSQRYSYARRYRTPSPDRSPVRSHRYGG 604 SP SN RGRSLSRSASPDGSPKRIRRGRGFSQRYSYARRYRTPSP+RSPVRSHRYGG Sbjct: 621 SPVSNHRGRSLSRSASPDGSPKRIRRGRGFSQRYSYARRYRTPSPERSPVRSHRYGG 677 >dbj|GAV70565.1| Pro_isomerase domain-containing protein [Cephalotus follicularis] Length = 784 Score = 109 bits (272), Expect = 3e-23 Identities = 51/56 (91%), Positives = 53/56 (94%) Frame = +2 Query: 437 SPPSNRGRSLSRSASPDGSPKRIRRGRGFSQRYSYARRYRTPSPDRSPVRSHRYGG 604 SPPS+ GRSLSRS SPDGSPKRIRRGRGFSQRYSYARRYRTPSPDRSPVRS+RY G Sbjct: 596 SPPSDHGRSLSRSVSPDGSPKRIRRGRGFSQRYSYARRYRTPSPDRSPVRSYRYSG 651 >ref|XP_010546571.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform X3 [Tarenaya hassleriana] Length = 735 Score = 108 bits (271), Expect = 4e-23 Identities = 51/55 (92%), Positives = 52/55 (94%) Frame = +2 Query: 437 SPPSNRGRSLSRSASPDGSPKRIRRGRGFSQRYSYARRYRTPSPDRSPVRSHRYG 601 SPPS+R RSLSRS SPDGSPKRIRRGRGFSQRYSYARRYRTPSPDRSP RSHRYG Sbjct: 548 SPPSDRRRSLSRSVSPDGSPKRIRRGRGFSQRYSYARRYRTPSPDRSPARSHRYG 602 >ref|XP_010546569.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform X1 [Tarenaya hassleriana] ref|XP_010546570.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform X2 [Tarenaya hassleriana] ref|XP_019058793.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform X1 [Tarenaya hassleriana] Length = 845 Score = 108 bits (271), Expect = 4e-23 Identities = 51/55 (92%), Positives = 52/55 (94%) Frame = +2 Query: 437 SPPSNRGRSLSRSASPDGSPKRIRRGRGFSQRYSYARRYRTPSPDRSPVRSHRYG 601 SPPS+R RSLSRS SPDGSPKRIRRGRGFSQRYSYARRYRTPSPDRSP RSHRYG Sbjct: 658 SPPSDRRRSLSRSVSPDGSPKRIRRGRGFSQRYSYARRYRTPSPDRSPARSHRYG 712 >gb|EOY31440.1| Peptidyl-prolyl cis-trans isomerase CYP19-2 isoform 5, partial [Theobroma cacao] Length = 579 Score = 108 bits (270), Expect = 4e-23 Identities = 51/56 (91%), Positives = 53/56 (94%) Frame = +2 Query: 437 SPPSNRGRSLSRSASPDGSPKRIRRGRGFSQRYSYARRYRTPSPDRSPVRSHRYGG 604 SPPSNRGRSLSRS SPD SPKRIRRGRGFS+RYSYARRYRTPSPDRS VRS+RYGG Sbjct: 380 SPPSNRGRSLSRSISPDASPKRIRRGRGFSERYSYARRYRTPSPDRSSVRSYRYGG 435 >gb|EOY31437.1| Peptidyl-prolyl cis-trans isomerase CYP19-2 isoform 2 [Theobroma cacao] Length = 733 Score = 108 bits (270), Expect = 5e-23 Identities = 51/56 (91%), Positives = 53/56 (94%) Frame = +2 Query: 437 SPPSNRGRSLSRSASPDGSPKRIRRGRGFSQRYSYARRYRTPSPDRSPVRSHRYGG 604 SPPSNRGRSLSRS SPD SPKRIRRGRGFS+RYSYARRYRTPSPDRS VRS+RYGG Sbjct: 532 SPPSNRGRSLSRSISPDASPKRIRRGRGFSERYSYARRYRTPSPDRSSVRSYRYGG 587 >ref|XP_017983288.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform X3 [Theobroma cacao] ref|XP_017983289.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP95 isoform X3 [Theobroma cacao] Length = 735 Score = 108 bits (270), Expect = 5e-23 Identities = 51/56 (91%), Positives = 53/56 (94%) Frame = +2 Query: 437 SPPSNRGRSLSRSASPDGSPKRIRRGRGFSQRYSYARRYRTPSPDRSPVRSHRYGG 604 SPPSNRGRSLSRS SPD SPKRIRRGRGFS+RYSYARRYRTPSPDRS VRS+RYGG Sbjct: 532 SPPSNRGRSLSRSISPDASPKRIRRGRGFSERYSYARRYRTPSPDRSSVRSYRYGG 587 >gb|EOY31436.1| Peptidyl-prolyl cis-trans isomerase CYP19-2 isoform 1 [Theobroma cacao] gb|EOY31438.1| Peptidyl-prolyl cis-trans isomerase CYP19-2 isoform 1 [Theobroma cacao] Length = 843 Score = 108 bits (270), Expect = 6e-23 Identities = 51/56 (91%), Positives = 53/56 (94%) Frame = +2 Query: 437 SPPSNRGRSLSRSASPDGSPKRIRRGRGFSQRYSYARRYRTPSPDRSPVRSHRYGG 604 SPPSNRGRSLSRS SPD SPKRIRRGRGFS+RYSYARRYRTPSPDRS VRS+RYGG Sbjct: 642 SPPSNRGRSLSRSISPDASPKRIRRGRGFSERYSYARRYRTPSPDRSSVRSYRYGG 697