BLASTX nr result
ID: Ophiopogon24_contig00012748
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00012748 (374 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK69525.1| uncharacterized protein A4U43_C05F23900 [Asparagu... 64 6e-10 ref|XP_020264592.1| LOW QUALITY PROTEIN: beta-glucuronosyltransf... 64 2e-09 >gb|ONK69525.1| uncharacterized protein A4U43_C05F23900 [Asparagus officinalis] Length = 196 Score = 63.9 bits (154), Expect = 6e-10 Identities = 28/38 (73%), Positives = 33/38 (86%) Frame = +2 Query: 2 SSWGDIDEVLPGKWAKRMKSLVSRIVSDDRLHLEQCKF 115 SSWG++DEV GKW +R+KSLV RIVSD+RL LEQCKF Sbjct: 159 SSWGNVDEVEAGKWGRRLKSLVERIVSDERLALEQCKF 196 >ref|XP_020264592.1| LOW QUALITY PROTEIN: beta-glucuronosyltransferase GlcAT14A-like [Asparagus officinalis] Length = 416 Score = 63.9 bits (154), Expect = 2e-09 Identities = 28/38 (73%), Positives = 33/38 (86%) Frame = +2 Query: 2 SSWGDIDEVLPGKWAKRMKSLVSRIVSDDRLHLEQCKF 115 SSWG++DEV GKW +R+KSLV RIVSD+RL LEQCKF Sbjct: 379 SSWGNVDEVEAGKWGRRLKSLVERIVSDERLALEQCKF 416