BLASTX nr result
ID: Ophiopogon24_contig00011276
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon24_contig00011276 (451 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020267156.1| uncharacterized protein LOC109842706 [Aspara... 78 2e-14 >ref|XP_020267156.1| uncharacterized protein LOC109842706 [Asparagus officinalis] gb|ONK68278.1| uncharacterized protein A4U43_C05F9580 [Asparagus officinalis] Length = 271 Score = 77.8 bits (190), Expect = 2e-14 Identities = 34/62 (54%), Positives = 46/62 (74%) Frame = +3 Query: 264 MSSHSLALTSAPQNWNHGNRYVSPYDDDYSQNRPHHGVPAPLHYRLEESGGMYSPWRLFE 443 MS LALT +P N + GN+Y S +DDDY+Q+ H+ +P PL Y+ E+ GG+Y+PWRLFE Sbjct: 1 MSYGRLALTLSPHNLSRGNQYESAHDDDYNQSHSHYFMPLPLLYQPEDGGGLYTPWRLFE 60 Query: 444 ER 449 ER Sbjct: 61 ER 62