BLASTX nr result
ID: Ophiopogon23_contig00041478
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00041478 (373 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ANH58202.1| glutathione S-transferase [Dracaena cambodiana] 81 3e-16 ref|XP_010938161.1| PREDICTED: glutathione S-transferase U8-like... 66 1e-10 ref|XP_008793317.1| PREDICTED: probable glutathione S-transferas... 66 1e-10 ref|XP_020272334.1| probable glutathione S-transferase [Asparagu... 61 2e-09 ref|XP_020275147.1| probable glutathione S-transferase [Asparagu... 62 4e-09 gb|ONK62802.1| uncharacterized protein A4U43_C07F8290 [Asparagus... 62 4e-09 ref|XP_020085955.1| probable glutathione S-transferase [Ananas c... 59 7e-08 gb|OAY66329.1| putative glutathione S-transferase [Ananas comosus] 58 2e-07 ref|XP_020085956.1| probable glutathione S-transferase [Ananas c... 58 2e-07 gb|OAY76198.1| putative glutathione S-transferase [Ananas comosus] 58 4e-07 gb|ANH58208.1| glutathione S-transferase [Dracaena cambodiana] 57 5e-07 ref|XP_008781207.1| PREDICTED: probable glutathione S-transferas... 57 5e-07 ref|XP_009399930.1| PREDICTED: probable glutathione S-transferas... 54 5e-06 gb|AGH14251.1| glutathione S-transferase [Musa acuminata AAA Group] 54 5e-06 ref|XP_020276032.1| glutathione S-transferase U8-like [Asparagus... 53 9e-06 >gb|ANH58202.1| glutathione S-transferase [Dracaena cambodiana] Length = 225 Score = 81.3 bits (199), Expect = 3e-16 Identities = 38/46 (82%), Positives = 40/46 (86%) Frame = -2 Query: 372 HPALWKWSQEFVSTDVVKECLPEREKFLALMQSKKEAILATKAPVY 235 HPALWKWSQEFVS+DVVKECLP REK A M S+KEAILATKAP Y Sbjct: 180 HPALWKWSQEFVSSDVVKECLPGREKLRARMLSRKEAILATKAPAY 225 >ref|XP_010938161.1| PREDICTED: glutathione S-transferase U8-like [Elaeis guineensis] Length = 226 Score = 66.2 bits (160), Expect = 1e-10 Identities = 28/44 (63%), Positives = 36/44 (81%) Frame = -2 Query: 372 HPALWKWSQEFVSTDVVKECLPEREKFLALMQSKKEAILATKAP 241 HP L+KW +EF+S+D+V ECLP RE+ LA Q+KKE +LATKAP Sbjct: 181 HPILFKWIEEFISSDIVVECLPARERLLAFFQAKKETMLATKAP 224 >ref|XP_008793317.1| PREDICTED: probable glutathione S-transferase [Phoenix dactylifera] Length = 226 Score = 66.2 bits (160), Expect = 1e-10 Identities = 30/46 (65%), Positives = 36/46 (78%) Frame = -2 Query: 372 HPALWKWSQEFVSTDVVKECLPEREKFLALMQSKKEAILATKAPVY 235 HP L+KW +EF+S+ +V ECLP RE LA Q+KKEAI ATKAPVY Sbjct: 181 HPILFKWIEEFMSSSIVMECLPAREGLLAYFQAKKEAIRATKAPVY 226 >ref|XP_020272334.1| probable glutathione S-transferase [Asparagus officinalis] Length = 107 Score = 60.8 bits (146), Expect = 2e-09 Identities = 23/38 (60%), Positives = 33/38 (86%) Frame = -2 Query: 372 HPALWKWSQEFVSTDVVKECLPEREKFLALMQSKKEAI 259 HP LW WS+EF S+D+VKEC+P+REK LA MQ++++A+ Sbjct: 70 HPNLWNWSREFTSSDIVKECIPDREKLLARMQARRDAM 107 >ref|XP_020275147.1| probable glutathione S-transferase [Asparagus officinalis] Length = 226 Score = 62.4 bits (150), Expect = 4e-09 Identities = 27/44 (61%), Positives = 33/44 (75%) Frame = -2 Query: 372 HPALWKWSQEFVSTDVVKECLPEREKFLALMQSKKEAILATKAP 241 HP LWKWSQ+FV+ DV K+CLP+REK LA Q +KEA+ A P Sbjct: 180 HPILWKWSQDFVNYDVCKKCLPQREKLLAFFQPRKEAMKAYVKP 223 >gb|ONK62802.1| uncharacterized protein A4U43_C07F8290 [Asparagus officinalis] Length = 227 Score = 62.4 bits (150), Expect = 4e-09 Identities = 27/44 (61%), Positives = 33/44 (75%) Frame = -2 Query: 372 HPALWKWSQEFVSTDVVKECLPEREKFLALMQSKKEAILATKAP 241 HP LWKWSQ+FV+ DV K+CLP+REK LA Q +KEA+ A P Sbjct: 181 HPILWKWSQDFVNYDVCKKCLPQREKLLAFFQPRKEAMKAYVKP 224 >ref|XP_020085955.1| probable glutathione S-transferase [Ananas comosus] Length = 259 Score = 59.3 bits (142), Expect = 7e-08 Identities = 26/46 (56%), Positives = 34/46 (73%) Frame = -2 Query: 372 HPALWKWSQEFVSTDVVKECLPEREKFLALMQSKKEAILATKAPVY 235 HP L +W +++V+ V+ECLP RE LAL + KEAI+ATKAPVY Sbjct: 213 HPILCRWIEDYVNYPTVRECLPAREGLLALFTANKEAIMATKAPVY 258 >gb|OAY66329.1| putative glutathione S-transferase [Ananas comosus] Length = 225 Score = 57.8 bits (138), Expect = 2e-07 Identities = 26/46 (56%), Positives = 34/46 (73%) Frame = -2 Query: 372 HPALWKWSQEFVSTDVVKECLPEREKFLALMQSKKEAILATKAPVY 235 HP L +W +++V+ VKE LP RE+ LA +KKEAI+ATKAPVY Sbjct: 179 HPNLCRWVEDYVNYPAVKEFLPARERLLAFFTAKKEAIMATKAPVY 224 >ref|XP_020085956.1| probable glutathione S-transferase [Ananas comosus] Length = 226 Score = 57.8 bits (138), Expect = 2e-07 Identities = 26/46 (56%), Positives = 34/46 (73%) Frame = -2 Query: 372 HPALWKWSQEFVSTDVVKECLPEREKFLALMQSKKEAILATKAPVY 235 HP L +W +++V+ VKE LP RE+ LA +KKEAI+ATKAPVY Sbjct: 180 HPNLCRWVEDYVNYPAVKEFLPARERLLAFFTAKKEAIMATKAPVY 225 >gb|OAY76198.1| putative glutathione S-transferase [Ananas comosus] Length = 421 Score = 57.8 bits (138), Expect = 4e-07 Identities = 26/46 (56%), Positives = 34/46 (73%) Frame = -2 Query: 372 HPALWKWSQEFVSTDVVKECLPEREKFLALMQSKKEAILATKAPVY 235 HP L +W +++V+ VKE LP RE+ LA +KKEAI+ATKAPVY Sbjct: 375 HPNLCRWVEDYVNYPAVKEFLPARERLLAFFTAKKEAIMATKAPVY 420 >gb|ANH58208.1| glutathione S-transferase [Dracaena cambodiana] Length = 220 Score = 56.6 bits (135), Expect = 5e-07 Identities = 20/40 (50%), Positives = 34/40 (85%) Frame = -2 Query: 372 HPALWKWSQEFVSTDVVKECLPEREKFLALMQSKKEAILA 253 HP +W+W++EF+ +DVVKEC P+REK L++ Q++K++ +A Sbjct: 180 HPVVWRWAREFLKSDVVKECTPKREKLLSMFQAQKDSKMA 219 >ref|XP_008781207.1| PREDICTED: probable glutathione S-transferase [Phoenix dactylifera] Length = 225 Score = 56.6 bits (135), Expect = 5e-07 Identities = 24/43 (55%), Positives = 34/43 (79%) Frame = -2 Query: 372 HPALWKWSQEFVSTDVVKECLPEREKFLALMQSKKEAILATKA 244 HP L+KW+ EF+S+D VKECLP +++ L+ Q+ KEA+ ATKA Sbjct: 180 HPILFKWANEFMSSDAVKECLPPKDELLSHFQAMKEAMSATKA 222 >ref|XP_009399930.1| PREDICTED: probable glutathione S-transferase [Musa acuminata subsp. malaccensis] Length = 224 Score = 53.9 bits (128), Expect = 5e-06 Identities = 24/45 (53%), Positives = 32/45 (71%) Frame = -2 Query: 372 HPALWKWSQEFVSTDVVKECLPEREKFLALMQSKKEAILATKAPV 238 +P L KW++EF+ +D V ECLP+R LA Q++K AI ATKA V Sbjct: 180 YPNLCKWTEEFLKSDAVMECLPKRANLLAFFQARKHAISATKASV 224 >gb|AGH14251.1| glutathione S-transferase [Musa acuminata AAA Group] Length = 224 Score = 53.9 bits (128), Expect = 5e-06 Identities = 24/45 (53%), Positives = 32/45 (71%) Frame = -2 Query: 372 HPALWKWSQEFVSTDVVKECLPEREKFLALMQSKKEAILATKAPV 238 +P L KW++EF+ +D V ECLP+R LA Q++K AI ATKA V Sbjct: 180 YPNLCKWTEEFLKSDAVMECLPKRANLLAFFQARKHAISATKASV 224 >ref|XP_020276032.1| glutathione S-transferase U8-like [Asparagus officinalis] gb|ONK62823.1| uncharacterized protein A4U43_C07F8500 [Asparagus officinalis] Length = 226 Score = 53.1 bits (126), Expect = 9e-06 Identities = 23/40 (57%), Positives = 28/40 (70%) Frame = -2 Query: 372 HPALWKWSQEFVSTDVVKECLPEREKFLALMQSKKEAILA 253 HP LWKW QEF+++DV K+ LPEREK + KKE I A Sbjct: 181 HPILWKWCQEFLNSDVAKKILPEREKLVDFYSGKKEFIQA 220