BLASTX nr result
ID: Ophiopogon23_contig00041428
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00041428 (538 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_588275.1| hypothetical protein ZeamMp009 (mitochondrion) ... 55 3e-10 ref|YP_008802509.1| ribosomal protein S4 (mitochondrion) [Asclep... 66 1e-09 ref|NP_064047.1| orf169 gene product (mitochondrion) [Beta vulga... 61 1e-09 emb|CBJ23345.1| hypothetical protein (mitochondrion) [Beta vulga... 61 1e-09 ref|YP_009173840.1| ribosomal protein S4 (mitochondrion) [Populu... 66 1e-09 ref|YP_002000578.1| ribosomal protein S4 (mitochondrion) [Oryza ... 66 2e-09 ref|YP_005090486.1| ribosomal protein S4 (mitochondrion) [Lotus ... 66 2e-09 ref|YP_005090450.1| ribosomal protein S4 (mitochondrion) [Millet... 66 2e-09 dbj|BAD83538.2| ribosomal protein S4, partial (mitochondrion) [N... 64 1e-08 ref|YP_717175.1| ribosomal protein S4 [Brassica napus] >gi|37591... 63 2e-08 sp|Q31708.2|RT04_ARATH RecName: Full=Ribosomal protein S4, mitoc... 63 2e-08 gb|ACH78250.1| ribosomal protein S4 (mitochondrion) [Arabidopsis... 63 2e-08 ref|YP_009430359.1| orf96 (mitochondrion) [Bupleurum falcatum] >... 54 3e-08 gb|AUD56971.1| ribosomal protein subunit S4 (mitochondrion) [Hym... 61 9e-08 gb|AUD56964.1| ribosomal protein subunit S4 (mitochondrion) [Cub... 61 9e-08 gb|AUD56965.1| ribosomal protein subunit S4 (mitochondrion) [Dep... 61 9e-08 gb|AUD56984.1| ribosomal protein subunit S4 (mitochondrion) [Ron... 61 9e-08 gb|AUD56961.1| ribosomal protein subunit S4 (mitochondrion) [Cep... 61 9e-08 ref|XP_010096993.1| uncharacterized protein LOC21407636 [Morus n... 61 1e-07 ref|YP_009243660.1| ribosomal protein S4 (mitochondrion) [Cannab... 61 1e-07 >ref|YP_588275.1| hypothetical protein ZeamMp009 (mitochondrion) [Zea mays subsp. mays] gb|AAR91139.1| hypothetical protein (mitochondrion) [Zea mays] Length = 115 Score = 55.1 bits (131), Expect(2) = 3e-10 Identities = 26/32 (81%), Positives = 26/32 (81%) Frame = -2 Query: 513 WAMFPERDCLLSGQQSTRSRRLLYDGLTSFPG 418 WAMFPERDCLLSGQQS RLLYD LTSF G Sbjct: 64 WAMFPERDCLLSGQQSYTYSRLLYDDLTSFLG 95 Score = 37.4 bits (85), Expect(2) = 3e-10 Identities = 18/20 (90%), Positives = 19/20 (95%) Frame = -3 Query: 425 FLGSARSSTLRPLQSK*KKR 366 FLGSARSSTLRP+QSK KKR Sbjct: 93 FLGSARSSTLRPIQSKSKKR 112 >ref|YP_008802509.1| ribosomal protein S4 (mitochondrion) [Asclepias syriaca] gb|AGZ63043.1| ribosomal protein S4 (mitochondrion) (mitochondrion) [Asclepias syriaca] Length = 274 Score = 66.2 bits (160), Expect = 1e-09 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +1 Query: 1 GPNIGHIPHDIRLKDLNLLLWSGNGYGQNI 90 GPNIGHIPHDIRLKDLNLLLWSGNG GQNI Sbjct: 245 GPNIGHIPHDIRLKDLNLLLWSGNGRGQNI 274 >ref|NP_064047.1| orf169 gene product (mitochondrion) [Beta vulgaris subsp. vulgaris] ref|YP_004222289.1| hypothetical protein BevumaM_p051 (mitochondrion) [Beta vulgaris subsp. maritima] ref|YP_004842203.1| hypothetical protein BemaM_p159 (mitochondrion) [Beta macrocarpa] dbj|BAA99357.1| orf169 (mitochondrion) [Beta vulgaris subsp. vulgaris] emb|CBJ14109.1| hypothetical protein (mitochondrion) [Beta vulgaris subsp. maritima] emb|CBJ17516.1| hypothetical protein (mitochondrion) [Beta vulgaris subsp. maritima] emb|CBX25008.1| hypothetical protein (mitochondrion) [Beta macrocarpa] emb|CBL52034.1| hypothetical protein (mitochondrion) [Beta vulgaris subsp. maritima] Length = 169 Score = 60.8 bits (146), Expect(2) = 1e-09 Identities = 28/30 (93%), Positives = 28/30 (93%) Frame = -3 Query: 530 KERREIGPCFPRETAFSQDSSRLEVEDCSM 441 KERREIGPCFPRE AFSQ SSRLEVEDCSM Sbjct: 110 KERREIGPCFPREAAFSQASSRLEVEDCSM 139 Score = 29.6 bits (65), Expect(2) = 1e-09 Identities = 13/19 (68%), Positives = 15/19 (78%) Frame = -2 Query: 426 FPGLCSLVYAPTTPVKMKK 370 FPGLCS VYAPT V ++K Sbjct: 144 FPGLCSPVYAPTHKVIIEK 162 >emb|CBJ23345.1| hypothetical protein (mitochondrion) [Beta vulgaris subsp. maritima] Length = 169 Score = 60.8 bits (146), Expect(2) = 1e-09 Identities = 28/30 (93%), Positives = 28/30 (93%) Frame = -3 Query: 530 KERREIGPCFPRETAFSQDSSRLEVEDCSM 441 KERREIGPCFPRE AFSQ SSRLEVEDCSM Sbjct: 110 KERREIGPCFPREAAFSQASSRLEVEDCSM 139 Score = 29.6 bits (65), Expect(2) = 1e-09 Identities = 13/19 (68%), Positives = 15/19 (78%) Frame = -2 Query: 426 FPGLCSLVYAPTTPVKMKK 370 FPGLCS VYAPT V ++K Sbjct: 144 FPGLCSPVYAPTHKVIIEK 162 >ref|YP_009173840.1| ribosomal protein S4 (mitochondrion) [Populus tremula] ref|YP_009178738.1| ribosomal protein S4 (mitochondrion) [Populus tremula x Populus alba] ref|YP_009230379.1| ribosomal protein S4 (mitochondrion) [Salix suchowensis] ref|YP_009239012.1| ribosomal protein S4 (mitochondrion) [Salix purpurea] ref|YP_009389182.1| ribosomal protein S4 (mitochondrion) [Populus davidiana] gb|ALH07315.1| ribosomal protein S4 (mitochondrion) [Populus tremula] gb|ALJ49771.1| ribosomal protein S4 (mitochondrion) [Populus tremula x Populus alba] gb|AMF83900.1| ribosomal protein S4 (mitochondrion) [Salix suchowensis] gb|AMO27196.1| ribosomal protein S4 (mitochondrion) [Salix purpurea] gb|ARX79189.1| ribosomal protein S4 (mitochondrion) [Populus davidiana] Length = 322 Score = 66.2 bits (160), Expect = 1e-09 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +1 Query: 1 GPNIGHIPHDIRLKDLNLLLWSGNGYGQNI 90 GPNIGHIPHDIRLKDLNLLLWSGNG GQNI Sbjct: 293 GPNIGHIPHDIRLKDLNLLLWSGNGRGQNI 322 >ref|YP_002000578.1| ribosomal protein S4 (mitochondrion) [Oryza sativa Japonica Group] dbj|BAC19883.2| Ribosomal protein S4 (mitochondrion) [Oryza sativa Japonica Group] Length = 352 Score = 66.2 bits (160), Expect = 2e-09 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +1 Query: 1 GPNIGHIPHDIRLKDLNLLLWSGNGYGQNI 90 GPNIGHIPHDIRLKDLNLLLWSGNG GQNI Sbjct: 323 GPNIGHIPHDIRLKDLNLLLWSGNGRGQNI 352 >ref|YP_005090486.1| ribosomal protein S4 (mitochondrion) [Lotus japonicus] gb|AET62946.1| ribosomal protein S4 (mitochondrion) [Lotus japonicus] Length = 358 Score = 66.2 bits (160), Expect = 2e-09 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +1 Query: 1 GPNIGHIPHDIRLKDLNLLLWSGNGYGQNI 90 GPNIGHIPHDIRLKDLNLLLWSGNG GQNI Sbjct: 329 GPNIGHIPHDIRLKDLNLLLWSGNGRGQNI 358 >ref|YP_005090450.1| ribosomal protein S4 (mitochondrion) [Millettia pinnata] ref|YP_005090457.1| ribosomal protein S4 (mitochondrion) [Millettia pinnata] gb|AET62910.1| ribosomal protein S4 (mitochondrion) [Millettia pinnata] gb|AET62917.1| ribosomal protein S4 (mitochondrion) [Millettia pinnata] Length = 358 Score = 66.2 bits (160), Expect = 2e-09 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +1 Query: 1 GPNIGHIPHDIRLKDLNLLLWSGNGYGQNI 90 GPNIGHIPHDIRLKDLNLLLWSGNG GQNI Sbjct: 329 GPNIGHIPHDIRLKDLNLLLWSGNGRGQNI 358 >dbj|BAD83538.2| ribosomal protein S4, partial (mitochondrion) [Nicotiana tabacum] Length = 349 Score = 63.9 bits (154), Expect = 1e-08 Identities = 28/30 (93%), Positives = 28/30 (93%) Frame = +1 Query: 1 GPNIGHIPHDIRLKDLNLLLWSGNGYGQNI 90 GPNIGHIPHDIRLKDLNLLLWSG G GQNI Sbjct: 320 GPNIGHIPHDIRLKDLNLLLWSGKGRGQNI 349 >ref|YP_717175.1| ribosomal protein S4 [Brassica napus] dbj|BAC98926.1| ribosomal protein S4 (mitochondrion) [Brassica napus] Length = 362 Score = 63.2 bits (152), Expect = 2e-08 Identities = 28/30 (93%), Positives = 28/30 (93%) Frame = +1 Query: 1 GPNIGHIPHDIRLKDLNLLLWSGNGYGQNI 90 GPNIGHIPHDIRLKDLNLLLWS NG GQNI Sbjct: 333 GPNIGHIPHDIRLKDLNLLLWSRNGRGQNI 362 >sp|Q31708.2|RT04_ARATH RecName: Full=Ribosomal protein S4, mitochondrial Length = 362 Score = 63.2 bits (152), Expect = 2e-08 Identities = 28/30 (93%), Positives = 28/30 (93%) Frame = +1 Query: 1 GPNIGHIPHDIRLKDLNLLLWSGNGYGQNI 90 GPNIGHIPHDIRLKDLNLLLWS NG GQNI Sbjct: 333 GPNIGHIPHDIRLKDLNLLLWSRNGRGQNI 362 >gb|ACH78250.1| ribosomal protein S4 (mitochondrion) [Arabidopsis thaliana] Length = 362 Score = 63.2 bits (152), Expect = 2e-08 Identities = 28/30 (93%), Positives = 28/30 (93%) Frame = +1 Query: 1 GPNIGHIPHDIRLKDLNLLLWSGNGYGQNI 90 GPNIGHIPHDIRLKDLNLLLWS NG GQNI Sbjct: 333 GPNIGHIPHDIRLKDLNLLLWSRNGRGQNI 362 >ref|YP_009430359.1| orf96 (mitochondrion) [Bupleurum falcatum] gb|ARR27491.1| orf96 (mitochondrion) [Bupleurum falcatum] Length = 121 Score = 53.5 bits (127), Expect(2) = 3e-08 Identities = 26/35 (74%), Positives = 28/35 (80%) Frame = -3 Query: 530 KERREIGPCFPRETAFSQDSSRLEVEDCSMTV*PL 426 KERREIGPCFPRE AFSQ SS L + DCSMT P+ Sbjct: 50 KERREIGPCFPREAAFSQASSLLLLVDCSMTGFPV 84 Score = 32.3 bits (72), Expect(2) = 3e-08 Identities = 15/19 (78%), Positives = 17/19 (89%) Frame = -1 Query: 424 SWALLARLRSDHSSQNEKN 368 SWALLARLRSD +SQN K+ Sbjct: 85 SWALLARLRSDPASQNLKS 103 >gb|AUD56971.1| ribosomal protein subunit S4 (mitochondrion) [Hymenodictyon parvifolium] Length = 274 Score = 60.8 bits (146), Expect = 9e-08 Identities = 28/30 (93%), Positives = 28/30 (93%) Frame = +1 Query: 1 GPNIGHIPHDIRLKDLNLLLWSGNGYGQNI 90 GPNIGHIPHDIRLKDLNLLL SGNG GQNI Sbjct: 245 GPNIGHIPHDIRLKDLNLLLRSGNGRGQNI 274 >gb|AUD56964.1| ribosomal protein subunit S4 (mitochondrion) [Cubanola domingensis] Length = 276 Score = 60.8 bits (146), Expect = 9e-08 Identities = 28/30 (93%), Positives = 28/30 (93%) Frame = +1 Query: 1 GPNIGHIPHDIRLKDLNLLLWSGNGYGQNI 90 GPNIGHIPHDIRLKDLNLLL SGNG GQNI Sbjct: 247 GPNIGHIPHDIRLKDLNLLLRSGNGRGQNI 276 >gb|AUD56965.1| ribosomal protein subunit S4 (mitochondrion) [Deppea grandiflora] gb|AUD56970.1| ribosomal protein subunit S4 (mitochondrion) [Hillia triflora] Length = 276 Score = 60.8 bits (146), Expect = 9e-08 Identities = 28/30 (93%), Positives = 28/30 (93%) Frame = +1 Query: 1 GPNIGHIPHDIRLKDLNLLLWSGNGYGQNI 90 GPNIGHIPHDIRLKDLNLLL SGNG GQNI Sbjct: 247 GPNIGHIPHDIRLKDLNLLLRSGNGRGQNI 276 >gb|AUD56984.1| ribosomal protein subunit S4 (mitochondrion) [Rondeletia odorata] Length = 276 Score = 60.8 bits (146), Expect = 9e-08 Identities = 28/30 (93%), Positives = 28/30 (93%) Frame = +1 Query: 1 GPNIGHIPHDIRLKDLNLLLWSGNGYGQNI 90 GPNIGHIPHDIRLKDLNLLL SGNG GQNI Sbjct: 247 GPNIGHIPHDIRLKDLNLLLRSGNGRGQNI 276 >gb|AUD56961.1| ribosomal protein subunit S4 (mitochondrion) [Cephalanthus occidentalis] Length = 282 Score = 60.8 bits (146), Expect = 9e-08 Identities = 28/30 (93%), Positives = 28/30 (93%) Frame = +1 Query: 1 GPNIGHIPHDIRLKDLNLLLWSGNGYGQNI 90 GPNIGHIPHDIRLKDLNLLL SGNG GQNI Sbjct: 253 GPNIGHIPHDIRLKDLNLLLRSGNGRGQNI 282 >ref|XP_010096993.1| uncharacterized protein LOC21407636 [Morus notabilis] gb|EXB66620.1| Ribosomal protein S4 [Morus notabilis] Length = 307 Score = 60.8 bits (146), Expect = 1e-07 Identities = 28/30 (93%), Positives = 28/30 (93%) Frame = +1 Query: 1 GPNIGHIPHDIRLKDLNLLLWSGNGYGQNI 90 GPNIGHIPHDIRLKDLNLLL SGNG GQNI Sbjct: 278 GPNIGHIPHDIRLKDLNLLLRSGNGRGQNI 307 >ref|YP_009243660.1| ribosomal protein S4 (mitochondrion) [Cannabis sativa] gb|ALF04067.1| ribosomal protein S4 (mitochondrion) [Cannabis sativa] gb|AMR97554.1| ribosomal protein S4 (mitochondrion) [Cannabis sativa] gb|ANC49136.1| ribosomal protein S4 (mitochondrion) [Cannabis sativa] Length = 352 Score = 60.8 bits (146), Expect = 1e-07 Identities = 28/30 (93%), Positives = 28/30 (93%) Frame = +1 Query: 1 GPNIGHIPHDIRLKDLNLLLWSGNGYGQNI 90 GPNIGHIPHDIRLKDLNLLL SGNG GQNI Sbjct: 323 GPNIGHIPHDIRLKDLNLLLRSGNGRGQNI 352