BLASTX nr result
ID: Ophiopogon23_contig00041276
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00041276 (591 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007413434.1| hypothetical protein MELLADRAFT_90339 [Melam... 57 8e-08 ref|XP_007413086.1| hypothetical protein MELLADRAFT_90064 [Melam... 59 1e-07 ref|XP_007417426.1| hypothetical protein MELLADRAFT_94723 [Melam... 60 1e-07 ref|XP_007411821.1| hypothetical protein MELLADRAFT_88316 [Melam... 59 2e-07 ref|XP_007417437.1| hypothetical protein MELLADRAFT_94736 [Melam... 59 2e-07 ref|XP_007411660.1| hypothetical protein MELLADRAFT_88127 [Melam... 59 2e-07 ref|XP_007405670.1| hypothetical protein MELLADRAFT_92511 [Melam... 59 4e-07 ref|XP_007410495.1| hypothetical protein MELLADRAFT_87416 [Melam... 59 5e-07 ref|XP_007416288.1| hypothetical protein MELLADRAFT_93283 [Melam... 59 5e-07 ref|XP_007414632.1| hypothetical protein MELLADRAFT_91701 [Melam... 59 7e-07 ref|XP_007415539.1| hypothetical protein MELLADRAFT_92706 [Melam... 59 9e-07 ref|XP_007419023.1| hypothetical protein MELLADRAFT_84531 [Melam... 59 1e-06 ref|XP_007413992.1| hypothetical protein MELLADRAFT_90626 [Melam... 59 1e-06 ref|XP_007419020.1| hypothetical protein MELLADRAFT_84525 [Melam... 59 1e-06 >ref|XP_007413434.1| hypothetical protein MELLADRAFT_90339 [Melampsora larici-populina 98AG31] gb|EGG03299.1| hypothetical protein MELLADRAFT_90339 [Melampsora larici-populina 98AG31] Length = 52 Score = 57.0 bits (136), Expect = 8e-08 Identities = 24/36 (66%), Positives = 29/36 (80%) Frame = -2 Query: 482 LYFHYA*GFNHPNTRIYVRLLGPCYKTGR*KPFRQN 375 ++FHY GF HPNTR +VRLLGPC+KTGR K F Q+ Sbjct: 16 IHFHYTFGFQHPNTRKHVRLLGPCFKTGRLKLFHQH 51 >ref|XP_007413086.1| hypothetical protein MELLADRAFT_90064 [Melampsora larici-populina 98AG31] gb|EGG03639.1| hypothetical protein MELLADRAFT_90064 [Melampsora larici-populina 98AG31] Length = 132 Score = 58.5 bits (140), Expect = 1e-07 Identities = 25/36 (69%), Positives = 30/36 (83%) Frame = -2 Query: 482 LYFHYA*GFNHPNTRIYVRLLGPCYKTGR*KPFRQN 375 ++FHYA GF HPNTR +VRLLGPC+KTGR K F Q+ Sbjct: 16 IHFHYAFGFQHPNTRKHVRLLGPCFKTGRLKLFHQH 51 >ref|XP_007417426.1| hypothetical protein MELLADRAFT_94723 [Melampsora larici-populina 98AG31] gb|EGF99326.1| hypothetical protein MELLADRAFT_94723 [Melampsora larici-populina 98AG31] Length = 244 Score = 60.5 bits (145), Expect = 1e-07 Identities = 30/51 (58%), Positives = 36/51 (70%) Frame = -2 Query: 482 LYFHYA*GFNHPNTRIYVRLLGPCYKTGR*KPFRQNR*QTSEFIQSSSTLL 330 ++FHYA GF HPNTR +VRLLGPC+KTGR K F Q+ F S ST+L Sbjct: 173 IHFHYAFGFQHPNTRKHVRLLGPCFKTGRLKLFHQH---PYNFTSSLSTIL 220 >ref|XP_007411821.1| hypothetical protein MELLADRAFT_88316 [Melampsora larici-populina 98AG31] gb|EGG05068.1| hypothetical protein MELLADRAFT_88316 [Melampsora larici-populina 98AG31] Length = 157 Score = 58.5 bits (140), Expect = 2e-07 Identities = 25/36 (69%), Positives = 30/36 (83%) Frame = -2 Query: 482 LYFHYA*GFNHPNTRIYVRLLGPCYKTGR*KPFRQN 375 ++FHYA GF HPNTR +VRLLGPC+KTGR K F Q+ Sbjct: 16 IHFHYAFGFQHPNTRKHVRLLGPCFKTGRLKLFHQH 51 >ref|XP_007417437.1| hypothetical protein MELLADRAFT_94736 [Melampsora larici-populina 98AG31] ref|XP_007418751.1| hypothetical protein MELLADRAFT_84120 [Melampsora larici-populina 98AG31] ref|XP_007419460.1| hypothetical protein MELLADRAFT_86113 [Melampsora larici-populina 98AG31] gb|EGF97272.1| hypothetical protein MELLADRAFT_86113 [Melampsora larici-populina 98AG31] gb|EGF97981.1| hypothetical protein MELLADRAFT_84120 [Melampsora larici-populina 98AG31] gb|EGF99317.1| hypothetical protein MELLADRAFT_94736 [Melampsora larici-populina 98AG31] Length = 157 Score = 58.5 bits (140), Expect = 2e-07 Identities = 25/36 (69%), Positives = 30/36 (83%) Frame = -2 Query: 482 LYFHYA*GFNHPNTRIYVRLLGPCYKTGR*KPFRQN 375 ++FHYA GF HPNTR +VRLLGPC+KTGR K F Q+ Sbjct: 16 IHFHYAFGFQHPNTRKHVRLLGPCFKTGRLKLFHQH 51 >ref|XP_007411660.1| hypothetical protein MELLADRAFT_88127 [Melampsora larici-populina 98AG31] gb|EGG05295.1| hypothetical protein MELLADRAFT_88127 [Melampsora larici-populina 98AG31] Length = 165 Score = 58.5 bits (140), Expect = 2e-07 Identities = 25/36 (69%), Positives = 30/36 (83%) Frame = -2 Query: 482 LYFHYA*GFNHPNTRIYVRLLGPCYKTGR*KPFRQN 375 ++FHYA GF HPNTR +VRLLGPC+KTGR K F Q+ Sbjct: 16 IHFHYAFGFQHPNTRKHVRLLGPCFKTGRLKLFHQH 51 >ref|XP_007405670.1| hypothetical protein MELLADRAFT_92511 [Melampsora larici-populina 98AG31] gb|EGG11068.1| hypothetical protein MELLADRAFT_92511 [Melampsora larici-populina 98AG31] Length = 202 Score = 58.5 bits (140), Expect = 4e-07 Identities = 25/36 (69%), Positives = 30/36 (83%) Frame = -2 Query: 482 LYFHYA*GFNHPNTRIYVRLLGPCYKTGR*KPFRQN 375 ++FHYA GF HPNTR +VRLLGPC+KTGR K F Q+ Sbjct: 125 IHFHYAFGFQHPNTRKHVRLLGPCFKTGRLKLFHQH 160 >ref|XP_007410495.1| hypothetical protein MELLADRAFT_87416 [Melampsora larici-populina 98AG31] gb|EGG06257.1| hypothetical protein MELLADRAFT_87416 [Melampsora larici-populina 98AG31] Length = 209 Score = 58.5 bits (140), Expect = 5e-07 Identities = 25/36 (69%), Positives = 30/36 (83%) Frame = -2 Query: 482 LYFHYA*GFNHPNTRIYVRLLGPCYKTGR*KPFRQN 375 ++FHYA GF HPNTR +VRLLGPC+KTGR K F Q+ Sbjct: 173 IHFHYAFGFQHPNTRKHVRLLGPCFKTGRLKLFHQH 208 >ref|XP_007416288.1| hypothetical protein MELLADRAFT_93283 [Melampsora larici-populina 98AG31] ref|XP_007417782.1| hypothetical protein MELLADRAFT_95026 [Melampsora larici-populina 98AG31] gb|EGF98956.1| hypothetical protein MELLADRAFT_95026 [Melampsora larici-populina 98AG31] gb|EGG00442.1| hypothetical protein MELLADRAFT_93283 [Melampsora larici-populina 98AG31] Length = 209 Score = 58.5 bits (140), Expect = 5e-07 Identities = 25/36 (69%), Positives = 30/36 (83%) Frame = -2 Query: 482 LYFHYA*GFNHPNTRIYVRLLGPCYKTGR*KPFRQN 375 ++FHYA GF HPNTR +VRLLGPC+KTGR K F Q+ Sbjct: 173 IHFHYAFGFQHPNTRKHVRLLGPCFKTGRLKLFHQH 208 >ref|XP_007414632.1| hypothetical protein MELLADRAFT_91701 [Melampsora larici-populina 98AG31] gb|EGG02095.1| hypothetical protein MELLADRAFT_91701 [Melampsora larici-populina 98AG31] Length = 250 Score = 58.5 bits (140), Expect = 7e-07 Identities = 25/36 (69%), Positives = 30/36 (83%) Frame = -2 Query: 482 LYFHYA*GFNHPNTRIYVRLLGPCYKTGR*KPFRQN 375 ++FHYA GF HPNTR +VRLLGPC+KTGR K F Q+ Sbjct: 173 IHFHYAFGFQHPNTRKHVRLLGPCFKTGRLKLFHQH 208 >ref|XP_007415539.1| hypothetical protein MELLADRAFT_92706 [Melampsora larici-populina 98AG31] gb|EGG01189.1| hypothetical protein MELLADRAFT_92706 [Melampsora larici-populina 98AG31] Length = 289 Score = 58.5 bits (140), Expect = 9e-07 Identities = 25/36 (69%), Positives = 30/36 (83%) Frame = -2 Query: 482 LYFHYA*GFNHPNTRIYVRLLGPCYKTGR*KPFRQN 375 ++FHYA GF HPNTR +VRLLGPC+KTGR K F Q+ Sbjct: 173 IHFHYAFGFQHPNTRKHVRLLGPCFKTGRLKLFHQH 208 >ref|XP_007419023.1| hypothetical protein MELLADRAFT_84531 [Melampsora larici-populina 98AG31] gb|EGF97700.1| hypothetical protein MELLADRAFT_84531 [Melampsora larici-populina 98AG31] Length = 314 Score = 58.5 bits (140), Expect = 1e-06 Identities = 25/36 (69%), Positives = 30/36 (83%) Frame = -2 Query: 482 LYFHYA*GFNHPNTRIYVRLLGPCYKTGR*KPFRQN 375 ++FHYA GF HPNTR +VRLLGPC+KTGR K F Q+ Sbjct: 173 IHFHYAFGFQHPNTRKHVRLLGPCFKTGRLKLFHQH 208 >ref|XP_007413992.1| hypothetical protein MELLADRAFT_90626 [Melampsora larici-populina 98AG31] gb|EGG02879.1| hypothetical protein MELLADRAFT_90626 [Melampsora larici-populina 98AG31] Length = 320 Score = 58.5 bits (140), Expect = 1e-06 Identities = 25/36 (69%), Positives = 30/36 (83%) Frame = -2 Query: 482 LYFHYA*GFNHPNTRIYVRLLGPCYKTGR*KPFRQN 375 ++FHYA GF HPNTR +VRLLGPC+KTGR K F Q+ Sbjct: 179 IHFHYAFGFQHPNTRKHVRLLGPCFKTGRLKLFHQH 214 >ref|XP_007419020.1| hypothetical protein MELLADRAFT_84525 [Melampsora larici-populina 98AG31] gb|EGF97697.1| hypothetical protein MELLADRAFT_84525 [Melampsora larici-populina 98AG31] Length = 347 Score = 58.5 bits (140), Expect = 1e-06 Identities = 25/36 (69%), Positives = 30/36 (83%) Frame = -2 Query: 482 LYFHYA*GFNHPNTRIYVRLLGPCYKTGR*KPFRQN 375 ++FHYA GF HPNTR +VRLLGPC+KTGR K F Q+ Sbjct: 311 IHFHYAFGFQHPNTRKHVRLLGPCFKTGRLKLFHQH 346