BLASTX nr result
ID: Ophiopogon23_contig00041196
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00041196 (395 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010922720.1| PREDICTED: transcription repressor OFP1-like... 58 3e-08 >ref|XP_010922720.1| PREDICTED: transcription repressor OFP1-like [Elaeis guineensis] Length = 389 Score = 58.2 bits (139), Expect(2) = 3e-08 Identities = 26/39 (66%), Positives = 30/39 (76%) Frame = +3 Query: 174 YIPNRPSYYISSNRPRTEHPSTSPAHPKASDTHFPLDPP 290 ++P+R SYYISS R TE P SP HPK SDTHFP+DPP Sbjct: 64 FLPSRASYYISS-RVETEKPPNSPFHPKTSDTHFPVDPP 101 Score = 27.3 bits (59), Expect(2) = 3e-08 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = +2 Query: 2 WFYKLKDMSSSNNNSKT 52 WFYKLKDM + S+T Sbjct: 16 WFYKLKDMGNRGRKSQT 32