BLASTX nr result
ID: Ophiopogon23_contig00041079
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00041079 (461 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK57445.1| uncharacterized protein A4U43_C09F590 [Asparagus ... 69 2e-12 >gb|ONK57445.1| uncharacterized protein A4U43_C09F590 [Asparagus officinalis] Length = 101 Score = 68.9 bits (167), Expect = 2e-12 Identities = 33/57 (57%), Positives = 42/57 (73%) Frame = -1 Query: 173 YGLQNRKNGVNIGCFNMAGVCKGGVDNTIDVHLDQFHEAEAITQIHGQLRVGCGNHS 3 +G QN NG+NIGC N AG V N I + LD+F+EAEA+ Q+HG+LRVGCGN+S Sbjct: 27 HGPQNSMNGINIGCDNWAG----HVGNNIGMCLDRFNEAEAVAQVHGKLRVGCGNYS 79