BLASTX nr result
ID: Ophiopogon23_contig00040851
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00040851 (512 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB39515.1| Solanesyl diphosphate synthase 3 [Morus notabilis] 48 9e-06 >gb|EXB39515.1| Solanesyl diphosphate synthase 3 [Morus notabilis] Length = 670 Score = 48.1 bits (113), Expect(2) = 9e-06 Identities = 22/36 (61%), Positives = 27/36 (75%) Frame = +3 Query: 270 VKWRSIFEVLCDHRMLVKLKDKFN*TTIRPSMLYGS 377 VKW+++ VLCD M +KLK KF T IRP+MLYGS Sbjct: 499 VKWKNVTGVLCDVEMPIKLKGKFYRTVIRPAMLYGS 534 Score = 28.9 bits (63), Expect(2) = 9e-06 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = +1 Query: 373 GQECRVVKEQHNQKMNIIVKRML 441 G EC +K QH KM++I RML Sbjct: 533 GSECWAIKRQHIAKMSVIEMRML 555