BLASTX nr result
ID: Ophiopogon23_contig00040839
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00040839 (442 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|OAY85566.1| NAD(P)H-quinone oxidoreductase subunit 2 B, chlor... 97 5e-23 gb|PPD67179.1| hypothetical protein GOBAR_DD35944 [Gossypium bar... 85 2e-16 gb|PHT98344.1| hypothetical protein BC332_32744 [Capsicum chinense] 78 3e-16 emb|CDY45543.1| BnaCnng13020D [Brassica napus] >gi|674913490|emb... 75 3e-14 ref|XP_017644477.1| PREDICTED: uncharacterized protein LOC108485... 77 1e-13 prf||1211235CE ORF 79 69 8e-13 ref|NP_054546.1| hypothetical protein NitaCp072 [Nicotiana tabac... 69 8e-13 ref|YP_001109547.1| hypothetical protein Poptr_cp068 [Populus tr... 68 2e-12 gb|PHU02057.1| hypothetical protein BC332_27308 [Capsicum chinense] 67 8e-12 gb|PHT71212.1| hypothetical protein T459_26316 [Capsicum annuum] 67 8e-12 gb|OQU76752.1| hypothetical protein SORBI_3010G201332, partial [... 65 9e-11 dbj|GAY31725.1| hypothetical protein CUMW_286240 [Citrus unshiu] 63 4e-10 gb|KQJ96841.1| hypothetical protein BRADI_3g27343v3, partial [Br... 62 1e-09 gb|KQJ95761.1| hypothetical protein BRADI_3g18879v3, partial [Br... 59 1e-08 gb|KRH52126.1| hypothetical protein GLYMA_06G048000 [Glycine max] 57 6e-08 gb|PPR94748.1| hypothetical protein GOBAR_AA25922 [Gossypium bar... 57 8e-08 gb|PAN11503.1| hypothetical protein PAHAL_B01798 [Panicum hallii] 57 1e-07 gb|PHT67205.1| hypothetical protein T459_26692 [Capsicum annuum] 55 3e-07 gb|KFK24812.1| hypothetical protein AALP_AA8G028100 [Arabis alpina] 52 3e-06 gb|PHU01065.1| hypothetical protein BC332_30852 [Capsicum chinense] 53 4e-06 >gb|OAY85566.1| NAD(P)H-quinone oxidoreductase subunit 2 B, chloroplastic [Ananas comosus] Length = 383 Score = 97.4 bits (241), Expect(2) = 5e-23 Identities = 53/71 (74%), Positives = 55/71 (77%) Frame = +2 Query: 194 HDRSIEILQHSIHLCXXXXXXXXXXXXXMEYDSLSRCLDGEMVDTRDSKSRAKERGGSSP 373 +DRSIEILQHS + MEYDSLSRCLDGEMVDTRDSKSRAKERGGSSP Sbjct: 323 YDRSIEILQHSTFI----------DIIFMEYDSLSRCLDGEMVDTRDSKSRAKERGGSSP 372 Query: 374 LQGIILRMLIE 406 LQGIILRMLIE Sbjct: 373 LQGIILRMLIE 383 Score = 38.1 bits (87), Expect(2) = 5e-23 Identities = 19/38 (50%), Positives = 24/38 (63%), Gaps = 2/38 (5%) Frame = +3 Query: 87 SIESRNRFDCTSF*YIG--YPTDNSNRSNLMSDLGPYD 194 +I N +C+ + + YP DNSNRSNLMSD G YD Sbjct: 287 NINEPNSCNCSGYPLLASRYPPDNSNRSNLMSDSGLYD 324 >gb|PPD67179.1| hypothetical protein GOBAR_DD35944 [Gossypium barbadense] Length = 400 Score = 84.7 bits (208), Expect = 2e-16 Identities = 42/43 (97%), Positives = 42/43 (97%) Frame = +2 Query: 278 MEYDSLSRCLDGEMVDTRDSKSRAKERGGSSPLQGIILRMLIE 406 MEYDSLSRCL GEMVDTRDSKSRAKERGGSSPLQGIILRMLIE Sbjct: 356 MEYDSLSRCLGGEMVDTRDSKSRAKERGGSSPLQGIILRMLIE 398 Score = 56.2 bits (134), Expect = 2e-06 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = +2 Query: 278 MEYDSLSRCLDGEMVDTRDSKSRAKERG 361 MEYDSL+RCL GEMVDTRDSKSRAKERG Sbjct: 302 MEYDSLARCLGGEMVDTRDSKSRAKERG 329 >gb|PHT98344.1| hypothetical protein BC332_32744 [Capsicum chinense] Length = 69 Score = 77.8 bits (190), Expect = 3e-16 Identities = 38/39 (97%), Positives = 38/39 (97%) Frame = +2 Query: 278 MEYDSLSRCLDGEMVDTRDSKSRAKERGGSSPLQGIILR 394 MEYDSLSRCL GEMVDTRDSKSRAKERGGSSPLQGIILR Sbjct: 1 MEYDSLSRCLGGEMVDTRDSKSRAKERGGSSPLQGIILR 39 >emb|CDY45543.1| BnaCnng13020D [Brassica napus] emb|CDY19675.1| BnaC09g29310D [Brassica napus] Length = 148 Score = 75.1 bits (183), Expect = 3e-14 Identities = 36/39 (92%), Positives = 38/39 (97%) Frame = +2 Query: 278 MEYDSLSRCLDGEMVDTRDSKSRAKERGGSSPLQGIILR 394 MEYDSLSRCL GEMVDTRDSKSRAK+RGGSSPLQGIIL+ Sbjct: 1 MEYDSLSRCLGGEMVDTRDSKSRAKKRGGSSPLQGIILK 39 >ref|XP_017644477.1| PREDICTED: uncharacterized protein LOC108485142 [Gossypium arboreum] Length = 369 Score = 77.0 bits (188), Expect = 1e-13 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = +2 Query: 278 MEYDSLSRCLDGEMVDTRDSKSRAKERGGSSPLQGIILRM 397 MEYDSLSRCL GEMVDTRDSKSRAKERGGSSPLQGIIL++ Sbjct: 323 MEYDSLSRCLGGEMVDTRDSKSRAKERGGSSPLQGIILKI 362 >prf||1211235CE ORF 79 Length = 79 Score = 69.3 bits (168), Expect = 8e-13 Identities = 41/72 (56%), Positives = 48/72 (66%), Gaps = 3/72 (4%) Frame = -2 Query: 210 SIDRSCHMGPSQTSNCFDLNYP*DT---LYIKKMYNQTYFSIQ*KPKEVNMVPK*R*ICQ 40 SIDRSCH+GPS TSNCFDLNYP + +Y K + + KEVN VP IC+ Sbjct: 11 SIDRSCHIGPSWTSNCFDLNYPENAMPDIYQKDGQSNLFLD---SLKEVNRVP--IEICK 65 Query: 39 KQVRLRLFLILN 4 KQVRLR+FLILN Sbjct: 66 KQVRLRVFLILN 77 >ref|NP_054546.1| hypothetical protein NitaCp072 [Nicotiana tabacum] ref|NP_054571.1| hypothetical protein NitaCp098 [Nicotiana tabacum] ref|YP_358726.1| hypothetical protein NisyCp082 [Nicotiana sylvestris] ref|YP_358752.1| hypothetical protein NisyCp111 [Nicotiana sylvestris] ref|YP_398912.1| hypothetical protein NitoCp081 [Nicotiana tomentosiformis] ref|YP_398938.1| hypothetical protein NitoCp109 [Nicotiana tomentosiformis] ref|YP_004891655.1| unnamed protein product (chloroplast) [Nicotiana undulata] ref|YP_004891681.1| unnamed protein product (chloroplast) [Nicotiana undulata] emb|CAA77389.1| hypothetical protein (chloroplast) [Nicotiana tabacum] emb|CAA77404.1| hypothetical protein (chloroplast) [Nicotiana tabacum] dbj|BAE46702.1| hypothetical protein (chloroplast) [Nicotiana sylvestris] dbj|BAE46729.1| hypothetical protein (chloroplast) [Nicotiana sylvestris] dbj|BAE48051.1| hypothetical protein (chloroplast) [Nicotiana tomentosiformis] dbj|BAE48078.1| hypothetical protein (chloroplast) [Nicotiana tomentosiformis] gb|AEO95593.1| hypothetical protein (chloroplast) [Nicotiana undulata] gb|AEO95638.1| hypothetical protein (chloroplast) [Nicotiana undulata] gb|AEO95703.1| hypothetical protein [synthetic construct] gb|AEO95746.1| hypothetical protein [synthetic construct] gb|AMM05591.1| hypothetical protein (plastid) [Nicotiana tabacum] gb|AMM05612.1| hypothetical protein (plastid) [Nicotiana tabacum] Length = 79 Score = 69.3 bits (168), Expect = 8e-13 Identities = 41/72 (56%), Positives = 48/72 (66%), Gaps = 3/72 (4%) Frame = -2 Query: 210 SIDRSCHMGPSQTSNCFDLNYP*DT---LYIKKMYNQTYFSIQ*KPKEVNMVPK*R*ICQ 40 SIDRSCH+GPS TSNCFDLNYP + +Y K + + KEVN VP IC+ Sbjct: 11 SIDRSCHIGPSWTSNCFDLNYPENAMPDIYQKDGQSNLFLD---SLKEVNRVP--IEICK 65 Query: 39 KQVRLRLFLILN 4 KQVRLR+FLILN Sbjct: 66 KQVRLRVFLILN 77 >ref|YP_001109547.1| hypothetical protein Poptr_cp068 [Populus trichocarpa] ref|YP_001109572.1| hypothetical protein Poptr_cp095 [Populus trichocarpa] ref|YP_009434068.1| hypothetical protein (chloroplast) [Populus lasiocarpa] gb|ABO36751.1| conserved hypothetical protein (chloroplast) [Populus trichocarpa] gb|ABO36776.1| conserved hypothetical protein (chloroplast) [Populus trichocarpa] gb|AOS86493.1| hypothetical protein (chloroplast) [Populus lasiocarpa] gb|APO09042.1| hypothetical protein (chloroplast) [Populus nigra] gb|APO09065.1| hypothetical protein (chloroplast) [Populus nigra] Length = 61 Score = 68.2 bits (165), Expect = 2e-12 Identities = 29/34 (85%), Positives = 31/34 (91%) Frame = -2 Query: 228 MECWSISIDRSCHMGPSQTSNCFDLNYP*DTLYI 127 +ECWSISIDRSCH+GPSQTSNCFDLNYP D L I Sbjct: 7 VECWSISIDRSCHIGPSQTSNCFDLNYPEDALSI 40 >gb|PHU02057.1| hypothetical protein BC332_27308 [Capsicum chinense] Length = 87 Score = 67.0 bits (162), Expect = 8e-12 Identities = 33/38 (86%), Positives = 34/38 (89%) Frame = +2 Query: 281 EYDSLSRCLDGEMVDTRDSKSRAKERGGSSPLQGIILR 394 EYDSLSRCLDGEM DTRDSKSRAK+ GGSSPLQG I R Sbjct: 11 EYDSLSRCLDGEMTDTRDSKSRAKKCGGSSPLQGNINR 48 >gb|PHT71212.1| hypothetical protein T459_26316 [Capsicum annuum] Length = 87 Score = 67.0 bits (162), Expect = 8e-12 Identities = 33/38 (86%), Positives = 34/38 (89%) Frame = +2 Query: 281 EYDSLSRCLDGEMVDTRDSKSRAKERGGSSPLQGIILR 394 EYDSLSRCLDGEM DTRDSKSRAK+ GGSSPLQG I R Sbjct: 11 EYDSLSRCLDGEMTDTRDSKSRAKKCGGSSPLQGNINR 48 >gb|OQU76752.1| hypothetical protein SORBI_3010G201332, partial [Sorghum bicolor] Length = 101 Score = 64.7 bits (156), Expect = 9e-11 Identities = 46/89 (51%), Positives = 56/89 (62%), Gaps = 2/89 (2%) Frame = +3 Query: 3 YLGLGIGVIGPAFDISIV-IWVPYSL-LWASIESRNRFDCTSF*YIGYPTDNSNRSNLMS 176 YLGLGIGVI PAFDISI+ ++V Y + L+ + +R C PTDN+NRS LMS Sbjct: 22 YLGLGIGVIRPAFDISILSLFVGYHMHLFGLLLNREIGLC--------PTDNANRSYLMS 73 Query: 177 DLGPYDMTDR*KYSNTPSTFVIYSIYHTR 263 D G Y + +R STFVIYSIYH R Sbjct: 74 DSGLY-VYERSIEILQDSTFVIYSIYHIR 101 >dbj|GAY31725.1| hypothetical protein CUMW_286240 [Citrus unshiu] Length = 109 Score = 63.2 bits (152), Expect = 4e-10 Identities = 26/39 (66%), Positives = 32/39 (82%) Frame = -2 Query: 219 WSISIDRSCHMGPSQTSNCFDLNYP*DTLYIKKMYNQTY 103 WSIS DRSCH+GP++TSNCFDLNYP D LYI +Y + + Sbjct: 13 WSISSDRSCHIGPNRTSNCFDLNYPEDALYILILYKKRW 51 >gb|KQJ96841.1| hypothetical protein BRADI_3g27343v3, partial [Brachypodium distachyon] gb|KQK18208.1| hypothetical protein BRADI_1g05797v3, partial [Brachypodium distachyon] Length = 98 Score = 61.6 bits (148), Expect = 1e-09 Identities = 43/88 (48%), Positives = 50/88 (56%), Gaps = 1/88 (1%) Frame = +3 Query: 3 YLGLGIGVIGPAFDISIVIWVPYSL-LWASIESRNRFDCTSF*YIGYPTDNSNRSNLMSD 179 YLGLGIGV PAFDISI+ Y + L+ + +R C PTDN+NRS LMSD Sbjct: 22 YLGLGIGVSRPAFDISILFLFGYHMHLFGLLLNREIGLC--------PTDNANRSYLMSD 73 Query: 180 LGPYDMTDR*KYSNTPSTFVIYSIYHTR 263 G YD + STFVIYSIY R Sbjct: 74 SGLYDRSIE---ILQDSTFVIYSIYRIR 98 >gb|KQJ95761.1| hypothetical protein BRADI_3g18879v3, partial [Brachypodium distachyon] Length = 98 Score = 58.9 bits (141), Expect = 1e-08 Identities = 42/88 (47%), Positives = 49/88 (55%), Gaps = 1/88 (1%) Frame = +3 Query: 3 YLGLGIGVIGPAFDISIVIWVPYSL-LWASIESRNRFDCTSF*YIGYPTDNSNRSNLMSD 179 YLGLGIGV PAFDISI+ Y + L+ + +R C PTDN+NRS LMSD Sbjct: 22 YLGLGIGVSRPAFDISILFLFGYHMHLFGLLLNREIGLC--------PTDNANRSYLMSD 73 Query: 180 LGPYDMTDR*KYSNTPSTFVIYSIYHTR 263 G Y + STFVIYSIY R Sbjct: 74 SGLYGRSIE---ILQDSTFVIYSIYRIR 98 >gb|KRH52126.1| hypothetical protein GLYMA_06G048000 [Glycine max] Length = 74 Score = 56.6 bits (135), Expect = 6e-08 Identities = 32/62 (51%), Positives = 38/62 (61%) Frame = +3 Query: 177 DLGPYDMTDR*KYSNTPSTFVIYSIYHTR*ISYSWNTIHFQDALMVKW*TRETQNLVLKS 356 D YD+ KYSNT + Y+ HTR ISYSWN IHFQDAL+VK T +T NL Sbjct: 12 DSWAYDLNQSIKYSNTLP--LSYAKLHTRYISYSWNMIHFQDALVVKSWTHKTLNLDFYG 69 Query: 357 VE 362 +E Sbjct: 70 IE 71 >gb|PPR94748.1| hypothetical protein GOBAR_AA25922 [Gossypium barbadense] Length = 111 Score = 57.4 bits (137), Expect = 8e-08 Identities = 27/28 (96%), Positives = 27/28 (96%) Frame = +2 Query: 278 MEYDSLSRCLDGEMVDTRDSKSRAKERG 361 MEYDSLSRCL GEMVDTRDSKSRAKERG Sbjct: 1 MEYDSLSRCLGGEMVDTRDSKSRAKERG 28 >gb|PAN11503.1| hypothetical protein PAHAL_B01798 [Panicum hallii] Length = 118 Score = 57.0 bits (136), Expect = 1e-07 Identities = 41/90 (45%), Positives = 48/90 (53%), Gaps = 7/90 (7%) Frame = +3 Query: 3 YLGLGIGVIGPAFDISIVIWVPYSLLWASIESRNRFDCTSF-------*YIGYPTDNSNR 161 YLGLGIGVI PAFDISI+ Y + + + F +I PTDN+NR Sbjct: 32 YLGLGIGVIRPAFDISILSLFGYHMHLFGLLLNRQIGLYIFLILISILIHIRCPTDNANR 91 Query: 162 SNLMSDLGPYDMTDR*KYSNTPSTFVIYSI 251 S LMSD G YD + STFVIYSI Sbjct: 92 SYLMSDSGLYDRSIE---ILQDSTFVIYSI 118 >gb|PHT67205.1| hypothetical protein T459_26692 [Capsicum annuum] Length = 505 Score = 54.7 bits (130), Expect(2) = 3e-07 Identities = 33/64 (51%), Positives = 39/64 (60%), Gaps = 3/64 (4%) Frame = -2 Query: 210 SIDRSCHMGPSQTSNCFDLNYP*DT---LYIKKMYNQTYFSIQ*KPKEVNMVPK*R*ICQ 40 SIDRSCH+GPS TSNCFDLNYP + +Y K + + KEVN VP IC+ Sbjct: 387 SIDRSCHIGPSWTSNCFDLNYPENAMPDIYQKDGQSNLFLD---SLKEVNRVPV--EICK 441 Query: 39 KQVR 28 QVR Sbjct: 442 NQVR 445 Score = 27.3 bits (59), Expect(2) = 3e-07 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 266 LSSVIYGIYDKGG 228 L SV+YGIYDKGG Sbjct: 374 LRSVMYGIYDKGG 386 >gb|KFK24812.1| hypothetical protein AALP_AA8G028100 [Arabis alpina] Length = 40 Score = 51.6 bits (122), Expect = 3e-06 Identities = 24/29 (82%), Positives = 28/29 (96%) Frame = -2 Query: 348 ARDFESRVSTISPSRHLESESYSMNMISI 262 ARDF+SRVSTISP +HLESESYS+NMI+I Sbjct: 12 ARDFKSRVSTISPPKHLESESYSINMIAI 40 >gb|PHU01065.1| hypothetical protein BC332_30852 [Capsicum chinense] Length = 124 Score = 53.1 bits (126), Expect = 4e-06 Identities = 26/32 (81%), Positives = 26/32 (81%) Frame = +2 Query: 278 MEYDSLSRCLDGEMVDTRDSKSRAKERGGSSP 373 MEYDSLS CL GEMVDTRDSKS AKE GG P Sbjct: 1 MEYDSLSICLGGEMVDTRDSKSHAKELGGIIP 32