BLASTX nr result
ID: Ophiopogon23_contig00040713
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00040713 (787 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020265161.1| cytochrome b561 domain-containing protein At... 102 2e-22 ref|XP_009416539.1| PREDICTED: cytochrome b561 domain-containing... 87 1e-16 ref|XP_020105421.1| cytochrome b561 domain-containing protein At... 85 9e-16 gb|ABF69967.1| hypothetical protein MA4_25J11.52 [Musa acuminata] 84 1e-15 ref|XP_008811094.1| PREDICTED: cytochrome b561 domain-containing... 81 1e-14 ref|XP_010924376.1| PREDICTED: cytochrome b561 domain-containing... 77 5e-13 ref|XP_010918848.1| PREDICTED: cytochrome b561 domain-containing... 76 1e-12 ref|XP_020700137.1| cytochrome b561 domain-containing protein At... 72 2e-12 ref|XP_020700136.1| cytochrome b561 domain-containing protein At... 72 2e-11 ref|XP_009387437.1| PREDICTED: cytochrome b561 domain-containing... 72 4e-11 ref|XP_009387436.1| PREDICTED: cytochrome b561 domain-containing... 72 4e-11 ref|XP_020597899.1| cytochrome b561 domain-containing protein At... 70 2e-10 ref|XP_018686629.1| PREDICTED: cytochrome b561 domain-containing... 69 5e-10 ref|XP_015387683.1| PREDICTED: cytochrome b561 domain-containing... 65 2e-09 ref|XP_023924860.1| cytochrome b561 domain-containing protein At... 66 5e-09 ref|XP_006437142.2| cytochrome b561 domain-containing protein At... 65 8e-09 ref|XP_015387682.1| PREDICTED: cytochrome b561 domain-containing... 65 8e-09 ref|XP_010275091.2| PREDICTED: cytochrome b561 domain-containing... 64 1e-08 gb|OAY60675.1| hypothetical protein MANES_01G130600 [Manihot esc... 65 1e-08 ref|XP_002307558.1| membrane family protein [Populus trichocarpa... 64 2e-08 >ref|XP_020265161.1| cytochrome b561 domain-containing protein At4g18260-like [Asparagus officinalis] gb|ONK69970.1| uncharacterized protein A4U43_C05F28850 [Asparagus officinalis] Length = 258 Score = 102 bits (255), Expect = 2e-22 Identities = 46/60 (76%), Positives = 55/60 (91%) Frame = -3 Query: 182 TETPRSAHTRKISQPSSTKLTPQLAFQIKLHAILLWASVGFLMPVGIIIIRMSQRIECGQ 3 TE+ RS HT KI+QP S+K+TPQL+FQIKLHA LLWASVGFLMP+GI++IRMSQR+ECGQ Sbjct: 30 TESRRSVHTHKITQPHSSKITPQLSFQIKLHAFLLWASVGFLMPIGILVIRMSQRVECGQ 89 >ref|XP_009416539.1| PREDICTED: cytochrome b561 domain-containing protein At2g30890-like isoform X1 [Musa acuminata subsp. malaccensis] ref|XP_018686627.1| PREDICTED: cytochrome b561 domain-containing protein At2g30890-like isoform X1 [Musa acuminata subsp. malaccensis] ref|XP_018686628.1| PREDICTED: cytochrome b561 domain-containing protein At2g30890-like isoform X1 [Musa acuminata subsp. malaccensis] Length = 251 Score = 87.0 bits (214), Expect = 1e-16 Identities = 40/57 (70%), Positives = 48/57 (84%) Frame = -3 Query: 179 ETPRSAHTRKISQPSSTKLTPQLAFQIKLHAILLWASVGFLMPVGIIIIRMSQRIEC 9 ETP+ T +ISQP+ +LTP+L+FQI +HA LLWASVGFLMPVGIIIIRMS R+EC Sbjct: 30 ETPKLVQTHRISQPNPLQLTPELSFQIGVHAFLLWASVGFLMPVGIIIIRMSHRVEC 86 >ref|XP_020105421.1| cytochrome b561 domain-containing protein At2g30890-like [Ananas comosus] Length = 256 Score = 84.7 bits (208), Expect = 9e-16 Identities = 41/59 (69%), Positives = 48/59 (81%), Gaps = 2/59 (3%) Frame = -3 Query: 173 PRSAHTRKISQPS--STKLTPQLAFQIKLHAILLWASVGFLMPVGIIIIRMSQRIECGQ 3 PR KISQPS S KLTPQL+FQIKLHA LLWASVGFLMP+GI++IRMS ++CG+ Sbjct: 33 PRLNQIHKISQPSPSSLKLTPQLSFQIKLHAFLLWASVGFLMPIGILVIRMSNTVQCGR 91 >gb|ABF69967.1| hypothetical protein MA4_25J11.52 [Musa acuminata] Length = 235 Score = 84.0 bits (206), Expect = 1e-15 Identities = 39/57 (68%), Positives = 47/57 (82%) Frame = -3 Query: 179 ETPRSAHTRKISQPSSTKLTPQLAFQIKLHAILLWASVGFLMPVGIIIIRMSQRIEC 9 ETP+ T +ISQ + +LTP+L+FQI +HA LLWASVGFLMPVGIIIIRMS R+EC Sbjct: 14 ETPKLVQTHRISQANPLQLTPELSFQIGVHAFLLWASVGFLMPVGIIIIRMSHRVEC 70 >ref|XP_008811094.1| PREDICTED: cytochrome b561 domain-containing protein At2g30890-like [Phoenix dactylifera] Length = 247 Score = 81.3 bits (199), Expect = 1e-14 Identities = 37/52 (71%), Positives = 43/52 (82%) Frame = -3 Query: 158 TRKISQPSSTKLTPQLAFQIKLHAILLWASVGFLMPVGIIIIRMSQRIECGQ 3 + K SQP KLTP+L+FQI LHA L WAS+GFLMPVGIIIIRMS R+ECG+ Sbjct: 37 SHKASQPEPLKLTPKLSFQITLHAFLFWASIGFLMPVGIIIIRMSNRVECGK 88 >ref|XP_010924376.1| PREDICTED: cytochrome b561 domain-containing protein At2g30890 [Elaeis guineensis] Length = 252 Score = 77.0 bits (188), Expect = 5e-13 Identities = 34/59 (57%), Positives = 46/59 (77%) Frame = -3 Query: 179 ETPRSAHTRKISQPSSTKLTPQLAFQIKLHAILLWASVGFLMPVGIIIIRMSQRIECGQ 3 ++ + + + K + + KLTP+L+FQI LHA LLWAS+GFLMPVGI IIRMS R+ECG+ Sbjct: 30 DSHKPSQSHKTRKQNQLKLTPELSFQITLHAFLLWASIGFLMPVGIFIIRMSNRVECGK 88 >ref|XP_010918848.1| PREDICTED: cytochrome b561 domain-containing protein At2g30890 [Elaeis guineensis] Length = 252 Score = 75.9 bits (185), Expect = 1e-12 Identities = 35/52 (67%), Positives = 42/52 (80%) Frame = -3 Query: 158 TRKISQPSSTKLTPQLAFQIKLHAILLWASVGFLMPVGIIIIRMSQRIECGQ 3 + K Q KLTP+L+ QIKLHA LLWAS+GFLMPVGIIIIRMS R++CG+ Sbjct: 37 SHKTRQHEPLKLTPKLSLQIKLHAFLLWASIGFLMPVGIIIIRMSNRVKCGK 88 >ref|XP_020700137.1| cytochrome b561 domain-containing protein At2g30890-like isoform X2 [Dendrobium catenatum] Length = 125 Score = 72.4 bits (176), Expect = 2e-12 Identities = 30/45 (66%), Positives = 40/45 (88%) Frame = -3 Query: 137 SSTKLTPQLAFQIKLHAILLWASVGFLMPVGIIIIRMSQRIECGQ 3 SS K T +L+FQ+KLHA LLWAS+GFLMPVGI++IR+S R++CG+ Sbjct: 10 SSVKFTTELSFQVKLHAFLLWASIGFLMPVGILVIRISNRVQCGR 54 >ref|XP_020700136.1| cytochrome b561 domain-containing protein At2g30890-like isoform X1 [Dendrobium catenatum] gb|PKU88054.1| hypothetical protein MA16_Dca019504 [Dendrobium catenatum] Length = 222 Score = 72.4 bits (176), Expect = 2e-11 Identities = 30/45 (66%), Positives = 40/45 (88%) Frame = -3 Query: 137 SSTKLTPQLAFQIKLHAILLWASVGFLMPVGIIIIRMSQRIECGQ 3 SS K T +L+FQ+KLHA LLWAS+GFLMPVGI++IR+S R++CG+ Sbjct: 10 SSVKFTTELSFQVKLHAFLLWASIGFLMPVGILVIRISNRVQCGR 54 >ref|XP_009387437.1| PREDICTED: cytochrome b561 domain-containing protein At2g30890-like isoform X3 [Musa acuminata subsp. malaccensis] Length = 256 Score = 72.0 bits (175), Expect = 4e-11 Identities = 35/58 (60%), Positives = 44/58 (75%), Gaps = 1/58 (1%) Frame = -3 Query: 179 ETPRSAHTRKISQPSST-KLTPQLAFQIKLHAILLWASVGFLMPVGIIIIRMSQRIEC 9 +TPR +R+ QP + +LTPQL+ QI +HA LLW SVGFLMPVGIIIIR+S R+ C Sbjct: 27 DTPRLVQSRRNGQPPNPLQLTPQLSTQITVHAFLLWVSVGFLMPVGIIIIRVSHRVHC 84 >ref|XP_009387436.1| PREDICTED: cytochrome b561 domain-containing protein At2g30890-like isoform X1 [Musa acuminata subsp. malaccensis] Length = 272 Score = 72.0 bits (175), Expect = 4e-11 Identities = 35/58 (60%), Positives = 44/58 (75%), Gaps = 1/58 (1%) Frame = -3 Query: 179 ETPRSAHTRKISQPSST-KLTPQLAFQIKLHAILLWASVGFLMPVGIIIIRMSQRIEC 9 +TPR +R+ QP + +LTPQL+ QI +HA LLW SVGFLMPVGIIIIR+S R+ C Sbjct: 27 DTPRLVQSRRNGQPPNPLQLTPQLSTQITVHAFLLWVSVGFLMPVGIIIIRVSHRVHC 84 >ref|XP_020597899.1| cytochrome b561 domain-containing protein At2g30890-like [Phalaenopsis equestris] Length = 248 Score = 69.7 bits (169), Expect = 2e-10 Identities = 30/45 (66%), Positives = 39/45 (86%) Frame = -3 Query: 137 SSTKLTPQLAFQIKLHAILLWASVGFLMPVGIIIIRMSQRIECGQ 3 SS K + +L FQ+KLHA LLWAS+GFLMPVGI+IIR+S R++CG+ Sbjct: 35 SSLKFSSELNFQVKLHAFLLWASIGFLMPVGILIIRISSRVQCGR 79 >ref|XP_018686629.1| PREDICTED: cytochrome b561 domain-containing protein At4g18260-like isoform X2 [Musa acuminata subsp. malaccensis] Length = 243 Score = 68.6 bits (166), Expect = 5e-10 Identities = 35/57 (61%), Positives = 40/57 (70%) Frame = -3 Query: 179 ETPRSAHTRKISQPSSTKLTPQLAFQIKLHAILLWASVGFLMPVGIIIIRMSQRIEC 9 ETP+ T +ISQP+ QI +HA LLWASVGFLMPVGIIIIRMS R+EC Sbjct: 30 ETPKLVQTHRISQPNP--------LQIGVHAFLLWASVGFLMPVGIIIIRMSHRVEC 78 >ref|XP_015387683.1| PREDICTED: cytochrome b561 domain-containing protein At2g30890 isoform X2 [Citrus sinensis] Length = 160 Score = 65.1 bits (157), Expect = 2e-09 Identities = 30/57 (52%), Positives = 42/57 (73%) Frame = -3 Query: 173 PRSAHTRKISQPSSTKLTPQLAFQIKLHAILLWASVGFLMPVGIIIIRMSQRIECGQ 3 P + + + Q ++ K++P+L QI +HA LLW S+GFLMPVGI+IIRMS R ECG+ Sbjct: 23 PSLSSSLQPEQSNNQKMSPKLLSQITVHAFLLWVSMGFLMPVGILIIRMSNREECGR 79 >ref|XP_023924860.1| cytochrome b561 domain-containing protein At4g18260-like [Quercus suber] gb|POE95289.1| cytochrome b561 domain-containing protein [Quercus suber] Length = 251 Score = 65.9 bits (159), Expect = 5e-09 Identities = 30/55 (54%), Positives = 43/55 (78%) Frame = -3 Query: 167 SAHTRKISQPSSTKLTPQLAFQIKLHAILLWASVGFLMPVGIIIIRMSQRIECGQ 3 ++H K + ++ KL+ +L F+I LH LLWAS+GFLMPVGI++IRMS R+ECG+ Sbjct: 34 TSHASK--KDNNHKLSSKLMFEITLHGFLLWASMGFLMPVGILVIRMSNRVECGR 86 >ref|XP_006437142.2| cytochrome b561 domain-containing protein At4g18260 [Citrus clementina] Length = 238 Score = 65.1 bits (157), Expect = 8e-09 Identities = 30/57 (52%), Positives = 42/57 (73%) Frame = -3 Query: 173 PRSAHTRKISQPSSTKLTPQLAFQIKLHAILLWASVGFLMPVGIIIIRMSQRIECGQ 3 P + + + Q ++ K++P+L QI +HA LLW S+GFLMPVGI+IIRMS R ECG+ Sbjct: 23 PSLSSSLQPEQSNTQKMSPKLLSQITVHAFLLWVSMGFLMPVGILIIRMSNREECGR 79 >ref|XP_015387682.1| PREDICTED: cytochrome b561 domain-containing protein At4g18260 isoform X1 [Citrus sinensis] gb|KDO51892.1| hypothetical protein CISIN_1g026424mg [Citrus sinensis] Length = 238 Score = 65.1 bits (157), Expect = 8e-09 Identities = 30/57 (52%), Positives = 42/57 (73%) Frame = -3 Query: 173 PRSAHTRKISQPSSTKLTPQLAFQIKLHAILLWASVGFLMPVGIIIIRMSQRIECGQ 3 P + + + Q ++ K++P+L QI +HA LLW S+GFLMPVGI+IIRMS R ECG+ Sbjct: 23 PSLSSSLQPEQSNNQKMSPKLLSQITVHAFLLWVSMGFLMPVGILIIRMSNREECGR 79 >ref|XP_010275091.2| PREDICTED: cytochrome b561 domain-containing protein At4g18260 [Nelumbo nucifera] Length = 207 Score = 64.3 bits (155), Expect = 1e-08 Identities = 27/41 (65%), Positives = 36/41 (87%) Frame = -3 Query: 125 LTPQLAFQIKLHAILLWASVGFLMPVGIIIIRMSQRIECGQ 3 ++P+L+F+I LH LLWAS+GFLMPVGI++IRMS R ECG+ Sbjct: 1 MSPELSFEIALHGFLLWASMGFLMPVGILLIRMSNREECGR 41 >gb|OAY60675.1| hypothetical protein MANES_01G130600 [Manihot esculenta] Length = 294 Score = 65.5 bits (158), Expect = 1e-08 Identities = 27/42 (64%), Positives = 37/42 (88%) Frame = -3 Query: 128 KLTPQLAFQIKLHAILLWASVGFLMPVGIIIIRMSQRIECGQ 3 KL+P+L F+I++H ILLW S+GFLMP+GI+IIR+S R ECG+ Sbjct: 111 KLSPKLVFEIRIHGILLWTSMGFLMPIGILIIRISNREECGK 152 >ref|XP_002307558.1| membrane family protein [Populus trichocarpa] gb|PNT37729.1| hypothetical protein POPTR_005G204300v3 [Populus trichocarpa] Length = 247 Score = 64.3 bits (155), Expect = 2e-08 Identities = 31/59 (52%), Positives = 41/59 (69%) Frame = -3 Query: 179 ETPRSAHTRKISQPSSTKLTPQLAFQIKLHAILLWASVGFLMPVGIIIIRMSQRIECGQ 3 E ++ TR ++ KL+P+L F+I LH LLWAS+GFLMPVGI+ IRMS R CG+ Sbjct: 30 EQLKTTGTRTNNENIMDKLSPKLLFEITLHGFLLWASMGFLMPVGILAIRMSHREACGR 88