BLASTX nr result
ID: Ophiopogon23_contig00040512
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00040512 (705 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_024329.1| hypothetical protein 85 [Saccharum hybrid culti... 102 2e-24 gb|PAN29683.1| hypothetical protein PAHAL_D01847 [Panicum hallii] 101 3e-24 ref|YP_009192343.1| hypothetical protein EC1Cp_p082 (chloroplast... 101 3e-24 ref|YP_009421900.1| putative protein 85 (chloroplast) [Miscanthu... 100 6e-24 gb|PAN11504.1| hypothetical protein PAHAL_B01799 [Panicum hallii] 97 1e-22 ref|NP_043078.1| hypothetical protein ZemaCp077 (chloroplast) [Z... 97 1e-22 gb|PAN48134.1| hypothetical protein PAHAL_I03692 [Panicum hallii] 95 1e-21 ref|YP_052804.1| hypothetical protein OrniCp078 (chloroplast) [O... 91 3e-20 ref|NP_039455.1| hypothetical protein OrsajCp100 (plastid) [Oryz... 89 2e-19 ref|YP_358632.1| hypothetical protein PhapfoPp086 [Phalaenopsis ... 88 1e-18 gb|AVE14550.1| Ycf15 (chloroplast) [Angelica tsinlingensis] 85 7e-18 gb|ERM97518.1| hypothetical protein AMTR_s05231p00006790, partia... 80 3e-16 gb|PHT34490.1| hypothetical protein CQW23_26290 [Capsicum baccatum] 86 4e-16 gb|ERN16192.1| hypothetical protein AMTR_s00030p00239160 [Ambore... 79 2e-15 gb|KQL10016.1| hypothetical protein SETIT_008430mg, partial [Set... 78 2e-15 ref|NP_039435.1| hypothetical protein OrsajCp078 (plastid) [Oryz... 77 3e-15 gb|KJB14970.1| hypothetical protein B456_002G152100, partial [Go... 55 7e-15 gb|AAO18644.1| hypothetical protein (chloroplast) [Lactuca sativ... 65 4e-14 gb|OMP12403.1| ORF46h [Corchorus olitorius] 74 1e-13 gb|PLY85626.1| hypothetical protein LSAT_0X40381 [Lactuca sativa] 65 2e-13 >ref|YP_024329.1| hypothetical protein 85 [Saccharum hybrid cultivar SP-80-3280] ref|YP_024350.1| hypothetical protein 85 [Saccharum hybrid cultivar SP-80-3280] ref|YP_054686.1| hypothetical protein SaofCp080 (chloroplast) [Saccharum hybrid cultivar NCo 310] ref|YP_054707.1| hypothetical protein SaofCp101 (chloroplast) [Saccharum hybrid cultivar NCo 310] ref|YP_003208241.1| hypothetical protein ColajoC_p079 (chloroplast) [Coix lacryma-jobi] ref|YP_003208260.1| hypothetical protein ColajoC_p098 (chloroplast) [Coix lacryma-jobi] ref|YP_009192464.1| hypothetical protein MsaCp_p081 (chloroplast) [Miscanthus sacchariflorus] ref|YP_009192489.1| hypothetical protein MsaCp_p106 (chloroplast) [Miscanthus sacchariflorus] ref|YP_009192586.1| hypothetical protein MsiCp_p081 (chloroplast) [Miscanthus sinensis] ref|YP_009192611.1| hypothetical protein MsiCp_p106 (chloroplast) [Miscanthus sinensis] ref|YP_009389623.1| putative protein 85 (chloroplast) [Saccharum officinarum] ref|YP_009389642.1| putative protein 85 (chloroplast) [Saccharum officinarum] ref|YP_009421794.1| putative protein 85 (chloroplast) [Miscanthus floridulus] ref|YP_009421813.1| putative protein 85 (chloroplast) [Miscanthus floridulus] ref|YP_009422006.1| putative protein 85 (chloroplast) [Miscanthus transmorrisonensis] ref|YP_009422025.1| putative protein 85 (chloroplast) [Miscanthus transmorrisonensis] ref|YP_009422112.1| putative protein 85 (chloroplast) [Miscanthus x giganteus] ref|YP_009422131.1| putative protein 85 (chloroplast) [Miscanthus x giganteus] sp|Q6ENQ6.1|YCF76_SACOF RecName: Full=Uncharacterized protein ycf76 sp|Q6L3C8.1|YCF76_SACHY RecName: Full=Uncharacterized protein ycf76 gb|AAT44644.1| hypothetical protein 85 (chloroplast) [Saccharum hybrid cultivar SP80-3280] gb|AAT44665.1| hypothetical protein 85 (chloroplast) [Saccharum hybrid cultivar SP80-3280] dbj|BAD27350.1| hypothetical protein (chloroplast) [Saccharum hybrid cultivar NCo 310] dbj|BAD27371.1| hypothetical protein (chloroplast) [Saccharum hybrid cultivar NCo 310] gb|ACI43246.1| unknown (chloroplast) [Coix lacryma-jobi] gb|ACI43253.1| unknown (chloroplast) [Coix lacryma-jobi] gb|ALP29691.1| hypothetical protein MsaCp_p081 (chloroplast) [Miscanthus sacchariflorus] gb|ALP29716.1| hypothetical protein MsaCp_p106 (chloroplast) [Miscanthus sacchariflorus] gb|ALP29813.1| hypothetical protein MsiCp_p081 (chloroplast) [Miscanthus sinensis] gb|ALP29838.1| hypothetical protein MsiCp_p106 (chloroplast) [Miscanthus sinensis] emb|CRK62364.1| putative protein 85 (chloroplast) [Saccharum spontaneum] emb|CRK62384.1| putative protein 85 (chloroplast) [Saccharum spontaneum] emb|CRK62592.1| putative protein 85 (chloroplast) [Saccharum officinarum] emb|CRK62612.1| putative protein 85 (chloroplast) [Saccharum officinarum] emb|CRK62483.1| putative protein 85 (chloroplast) [Saccharum hybrid cultivar] emb|CRK62503.1| putative protein 85 (chloroplast) [Saccharum hybrid cultivar] emb|CRY90718.1| putative protein 85 (chloroplast) [Miscanthus floridulus] emb|CRY90738.1| putative protein 85 (chloroplast) [Miscanthus floridulus] emb|CRY89193.1| putative protein 85 (chloroplast) [Miscanthus sacchariflorus] emb|CRY89213.1| putative protein 85 (chloroplast) [Miscanthus sacchariflorus] emb|CRY89302.1| putative protein 85 (chloroplast) [Miscanthus sacchariflorus] emb|CRY89322.1| putative protein 85 (chloroplast) [Miscanthus sacchariflorus] emb|CRY89411.1| putative protein 85 (chloroplast) [Miscanthus sacchariflorus] emb|CRY89431.1| putative protein 85 (chloroplast) [Miscanthus sacchariflorus] emb|CRY89520.1| putative protein 85 (chloroplast) [Miscanthus sinensis subsp. condensatus] emb|CRY89540.1| putative protein 85 (chloroplast) [Miscanthus sinensis subsp. condensatus] emb|CRY89629.1| putative protein 85 (chloroplast) [Miscanthus sinensis subsp. sinensis] emb|CRY89649.1| putative protein 85 (chloroplast) [Miscanthus sinensis subsp. sinensis] emb|CRY89738.1| putative protein 85 (chloroplast) [Miscanthus sinensis subsp. sinensis] emb|CRY89758.1| putative protein 85 (chloroplast) [Miscanthus sinensis subsp. sinensis] emb|CRY89847.1| putative protein 85 (chloroplast) [Miscanthus sinensis subsp. sinensis] emb|CRY89867.1| putative protein 85 (chloroplast) [Miscanthus sinensis subsp. sinensis] emb|CRY89956.1| putative protein 85 (chloroplast) [Miscanthus sinensis var. purpurascens] emb|CRY89976.1| putative protein 85 (chloroplast) [Miscanthus sinensis var. purpurascens] emb|CRY90065.1| putative protein 85 (chloroplast) [Miscanthus sinensis subsp. sinensis] emb|CRY90085.1| putative protein 85 (chloroplast) [Miscanthus sinensis subsp. sinensis] emb|CRY90174.1| putative protein 85 (chloroplast) [Miscanthus sinensis subsp. sinensis] emb|CRY90194.1| putative protein 85 (chloroplast) [Miscanthus sinensis subsp. sinensis] emb|CRY90283.1| putative protein 85 (chloroplast) [Miscanthus sinensis subsp. sinensis] emb|CRY90303.1| putative protein 85 (chloroplast) [Miscanthus sinensis subsp. sinensis] emb|CRY90391.1| putative protein 85 (chloroplast) [Miscanthus sinensis subsp. sinensis] emb|CRY90411.1| putative protein 85 (chloroplast) [Miscanthus sinensis subsp. sinensis] emb|CRY90500.1| putative protein 85 (chloroplast) [Miscanthus transmorrisonensis] emb|CRY90520.1| putative protein 85 (chloroplast) [Miscanthus transmorrisonensis] emb|CRY90609.1| putative protein 85 (chloroplast) [Miscanthus x giganteus] emb|CRY90629.1| putative protein 85 (chloroplast) [Miscanthus x giganteus] gb|ASV52303.1| hypothetical protein (chloroplast) [Saccharum officinarum] gb|ASV52324.1| hypothetical protein (chloroplast) [Saccharum officinarum] emb|CUS18937.1| putative protein 85 (plastid) [Miscanthus sinensis subsp. sinensis] emb|CUS18956.1| putative protein 85 (plastid) [Miscanthus sinensis subsp. sinensis] emb|CUS19204.1| putative protein 85 (chloroplast) [Saccharum hybrid cultivar] emb|CUS19223.1| putative protein 85 (chloroplast) [Saccharum hybrid cultivar] emb|CUS19096.1| putative protein 85 (chloroplast) [Saccharum spontaneum] emb|CUS19115.1| putative protein 85 (chloroplast) [Saccharum spontaneum] Length = 85 Score = 102 bits (253), Expect = 2e-24 Identities = 49/65 (75%), Positives = 54/65 (83%) Frame = -3 Query: 220 VKKRGEAEQVKMIWITPSSCAKDLTISEGTGATFLFNFHSRVSMCFHAISFFEVSKKKKW 41 +KK G+ QVKMIWI PSSCAKDLTISEGTGATFLFNFHSRVS+CFHA+ F + KW Sbjct: 23 LKKEGKQNQVKMIWIAPSSCAKDLTISEGTGATFLFNFHSRVSICFHAL--FLRPRNMKW 80 Query: 40 TNSFS 26 TNSFS Sbjct: 81 TNSFS 85 >gb|PAN29683.1| hypothetical protein PAHAL_D01847 [Panicum hallii] Length = 85 Score = 101 bits (252), Expect = 3e-24 Identities = 48/65 (73%), Positives = 54/65 (83%) Frame = -3 Query: 220 VKKRGEAEQVKMIWITPSSCAKDLTISEGTGATFLFNFHSRVSMCFHAISFFEVSKKKKW 41 +KK G+ QVKMIW+ PSSCAKDLTISEGTGATFLFNFHSRVS+CFHA+ F + KW Sbjct: 23 LKKEGKQNQVKMIWVAPSSCAKDLTISEGTGATFLFNFHSRVSICFHAL--FLRPRNMKW 80 Query: 40 TNSFS 26 TNSFS Sbjct: 81 TNSFS 85 >ref|YP_009192343.1| hypothetical protein EC1Cp_p082 (chloroplast) [Echinochloa crus-galli] ref|YP_009192366.1| hypothetical protein EC1Cp_p105 (chloroplast) [Echinochloa crus-galli] gb|ALP29326.1| hypothetical protein EC1Cp_p082 (chloroplast) [Echinochloa crus-galli] gb|ALP29349.1| hypothetical protein EC1Cp_p105 (chloroplast) [Echinochloa crus-galli] gb|ALP29448.1| hypothetical protein EC2Cp_p082 (chloroplast) [Echinochloa crus-galli var. crus-galli] gb|ALP29471.1| hypothetical protein EC2Cp_p105 (chloroplast) [Echinochloa crus-galli var. crus-galli] gb|ALP29570.1| hypothetical protein EC3Cp_p082 (chloroplast) [Echinochloa crus-galli var. praticola] gb|ALP29593.1| hypothetical protein EC3Cp_p105 (chloroplast) [Echinochloa crus-galli var. praticola] Length = 85 Score = 101 bits (252), Expect = 3e-24 Identities = 48/65 (73%), Positives = 54/65 (83%) Frame = -3 Query: 220 VKKRGEAEQVKMIWITPSSCAKDLTISEGTGATFLFNFHSRVSMCFHAISFFEVSKKKKW 41 +KK G+ QVKMIW+ PSSCAKDLTISEGTGATFLFNFHSRVS+CFHA+ F + KW Sbjct: 23 LKKEGKQNQVKMIWVAPSSCAKDLTISEGTGATFLFNFHSRVSICFHAL--FLRPRNMKW 80 Query: 40 TNSFS 26 TNSFS Sbjct: 81 TNSFS 85 >ref|YP_009421900.1| putative protein 85 (chloroplast) [Miscanthus junceus] ref|YP_009421919.1| putative protein 85 (chloroplast) [Miscanthus junceus] emb|CRY89084.1| putative protein 85 (chloroplast) [Miscanthus junceus] emb|CRY89104.1| putative protein 85 (chloroplast) [Miscanthus junceus] Length = 85 Score = 100 bits (250), Expect = 6e-24 Identities = 48/65 (73%), Positives = 54/65 (83%) Frame = -3 Query: 220 VKKRGEAEQVKMIWITPSSCAKDLTISEGTGATFLFNFHSRVSMCFHAISFFEVSKKKKW 41 +KK G+ QVKMIWI PSSCAKDLTISEGTGATFLFNFH+RVS+CFHA+ F + KW Sbjct: 23 LKKEGKQNQVKMIWIAPSSCAKDLTISEGTGATFLFNFHARVSICFHAL--FLRPRNMKW 80 Query: 40 TNSFS 26 TNSFS Sbjct: 81 TNSFS 85 >gb|PAN11504.1| hypothetical protein PAHAL_B01799 [Panicum hallii] Length = 85 Score = 97.4 bits (241), Expect = 1e-22 Identities = 47/65 (72%), Positives = 53/65 (81%) Frame = -3 Query: 220 VKKRGEAEQVKMIWITPSSCAKDLTISEGTGATFLFNFHSRVSMCFHAISFFEVSKKKKW 41 +KK G+ QVKMIW+ PSS AKDLTISEGTGATFLFNFHSRVS+CFHA+ F + KW Sbjct: 23 LKKEGKQNQVKMIWVAPSSYAKDLTISEGTGATFLFNFHSRVSICFHAL--FLRPRNMKW 80 Query: 40 TNSFS 26 TNSFS Sbjct: 81 TNSFS 85 >ref|NP_043078.1| hypothetical protein ZemaCp077 (chloroplast) [Zea mays] ref|NP_043099.1| hypothetical protein ZemaCp098 (chloroplast) [Zea mays] sp|Q36997.1|YCF76_MAIZE RecName: Full=Uncharacterized protein ycf76; AltName: Full=ORF85 emb|CAA60340.1| hypothetical protein (chloroplast) [Zea mays] emb|CAA60360.1| hypothetical protein (chloroplast) [Zea mays] Length = 85 Score = 97.4 bits (241), Expect = 1e-22 Identities = 47/65 (72%), Positives = 53/65 (81%) Frame = -3 Query: 220 VKKRGEAEQVKMIWITPSSCAKDLTISEGTGATFLFNFHSRVSMCFHAISFFEVSKKKKW 41 +KK G+ QVKMIWI PSSCAKDLTISEGTGATF F+FHSRVS+CFHA+ F + KW Sbjct: 23 LKKEGKQNQVKMIWIAPSSCAKDLTISEGTGATFPFHFHSRVSICFHAL--FLRPRNMKW 80 Query: 40 TNSFS 26 TNSFS Sbjct: 81 TNSFS 85 >gb|PAN48134.1| hypothetical protein PAHAL_I03692 [Panicum hallii] Length = 78 Score = 94.7 bits (234), Expect = 1e-21 Identities = 45/65 (69%), Positives = 51/65 (78%) Frame = -3 Query: 220 VKKRGEAEQVKMIWITPSSCAKDLTISEGTGATFLFNFHSRVSMCFHAISFFEVSKKKKW 41 +KK G+ QVKMIW+ PSSCAKDLTISEGT TFLFNFHSRVS+CFHA+ F + KW Sbjct: 16 LKKEGKQNQVKMIWVAPSSCAKDLTISEGTETTFLFNFHSRVSICFHAL--FLRPRNMKW 73 Query: 40 TNSFS 26 NSFS Sbjct: 74 INSFS 78 >ref|YP_052804.1| hypothetical protein OrniCp078 (chloroplast) [Oryza nivara] ref|YP_052828.1| hypothetical protein OrniCp102 (chloroplast) [Oryza nivara] sp|Q6EN94.1|YCF76_ORYNI RecName: Full=Uncharacterized protein ycf76; AltName: Full=ORF72 dbj|BAD26834.1| unnamed protein product (chloroplast) [Oryza nivara] dbj|BAD26858.1| unnamed protein product (chloroplast) [Oryza nivara] gb|AGY48998.1| hypothetical protein Ycf76 (chloroplast) [Oryza rufipogon] gb|AGY49024.1| hypothetical protein Ycf76 (chloroplast) [Oryza rufipogon] Length = 72 Score = 90.9 bits (224), Expect = 3e-20 Identities = 40/49 (81%), Positives = 45/49 (91%) Frame = -3 Query: 220 VKKRGEAEQVKMIWITPSSCAKDLTISEGTGATFLFNFHSRVSMCFHAI 74 +KK G+ QVKMIW+ PSSCAKDLTISEGTGATFLFNFHSRVS+CFHA+ Sbjct: 23 LKKEGKQNQVKMIWVAPSSCAKDLTISEGTGATFLFNFHSRVSICFHAL 71 >ref|NP_039455.1| hypothetical protein OrsajCp100 (plastid) [Oryza sativa Japonica Group] sp|Q32766.1|YCF76_ORYSJ RecName: Full=Uncharacterized protein ycf76; AltName: Full=ORF85 sp|P0C472.1|YCF76_ORYSI RecName: Full=Uncharacterized protein ycf76; AltName: Full=ORF85 sp|P0C471.1|YCF76_ORYSA RecName: Full=Uncharacterized protein ycf76; AltName: Full=ORF85 emb|CAA33916.1| unnamed protein product (chloroplast) [Oryza sativa Japonica Group] prf||1603356DF ORF 85B [Oryza sativa] Length = 85 Score = 89.4 bits (220), Expect = 2e-19 Identities = 45/65 (69%), Positives = 49/65 (75%) Frame = -3 Query: 220 VKKRGEAEQVKMIWITPSSCAKDLTISEGTGATFLFNFHSRVSMCFHAISFFEVSKKKKW 41 +KK G+ QVKMIW+ PSSCAKDLTISEGTGATFLFNFHSRVS F F + KW Sbjct: 23 LKKEGKQNQVKMIWVAPSSCAKDLTISEGTGATFLFNFHSRVSYLFPRP--FLRPRNMKW 80 Query: 40 TNSFS 26 TNSFS Sbjct: 81 TNSFS 85 >ref|YP_358632.1| hypothetical protein PhapfoPp086 [Phalaenopsis aphrodite subsp. formosana] gb|AAW82568.1| hypothetical protein (chloroplast) [Phalaenopsis aphrodite subsp. formosana] Length = 115 Score = 88.2 bits (217), Expect = 1e-18 Identities = 43/61 (70%), Positives = 48/61 (78%), Gaps = 2/61 (3%) Frame = -2 Query: 239 KNPTRYC*KKR-GSRTSQDDMDHPFFLRQRSY-HFRRNWSYISFQFPFQSFYVFPRHFIF 66 + PTRYC KKR + SQDDM+HPFFLRQ SY HFR+NWSY SF FPFQS YVFPR F+ Sbjct: 16 EEPTRYCKKKRVEAEPSQDDMNHPFFLRQGSYYHFRKNWSYFSFPFPFQSSYVFPRPFLR 75 Query: 65 R 63 R Sbjct: 76 R 76 >gb|AVE14550.1| Ycf15 (chloroplast) [Angelica tsinlingensis] Length = 87 Score = 85.1 bits (209), Expect = 7e-18 Identities = 40/56 (71%), Positives = 45/56 (80%) Frame = -2 Query: 176 HPFFLRQRSYHFRRNWSYISFQFPFQSFYVFPRHFIFRGLKKKEMDKFLFLGTHTR 9 +PFFLRQRSYHFR NWSYI F F F+SFYVFP R L+ ++MDKFLFLGTHTR Sbjct: 5 NPFFLRQRSYHFRSNWSYIYFPFQFKSFYVFP-----RPLRPRKMDKFLFLGTHTR 55 >gb|ERM97518.1| hypothetical protein AMTR_s05231p00006790, partial [Amborella trichopoda] Length = 77 Score = 80.5 bits (197), Expect = 3e-16 Identities = 41/45 (91%), Positives = 42/45 (93%) Frame = -2 Query: 704 PTLSRQSHKPLIHSRSIAAGEQVKIEKLTLGLGIIRLELMTSTTS 570 PT SRQSH+PLIHS SI AGEQVKIEKLTLGLGIIRLELMTSTTS Sbjct: 33 PTPSRQSHEPLIHSHSITAGEQVKIEKLTLGLGIIRLELMTSTTS 77 >gb|PHT34490.1| hypothetical protein CQW23_26290 [Capsicum baccatum] Length = 330 Score = 86.3 bits (212), Expect = 4e-16 Identities = 39/51 (76%), Positives = 43/51 (84%) Frame = -1 Query: 705 PYPITSIPQASYPFSFDRCGGASQNRKTHIGFRDNQARTDDFHHVKVTLYR 553 P P+TSIP+ASYPFS + GGA+ RKTHIG RDNQARTDDFHHVKV LYR Sbjct: 280 PCPLTSIPRASYPFSLNDSGGANPTRKTHIGLRDNQARTDDFHHVKVKLYR 330 >gb|ERN16192.1| hypothetical protein AMTR_s00030p00239160 [Amborella trichopoda] Length = 89 Score = 79.0 bits (193), Expect = 2e-15 Identities = 37/50 (74%), Positives = 41/50 (82%) Frame = -1 Query: 702 YPITSIPQASYPFSFDRCGGASQNRKTHIGFRDNQARTDDFHHVKVTLYR 553 YP+ S+PQASY FSFD GGASQN+K IGFRDN ART +FHHVKVTL R Sbjct: 40 YPLKSLPQASYAFSFDHGGGASQNKKACIGFRDNHARTYEFHHVKVTLDR 89 >gb|KQL10016.1| hypothetical protein SETIT_008430mg, partial [Setaria italica] Length = 66 Score = 78.2 bits (191), Expect = 2e-15 Identities = 35/44 (79%), Positives = 39/44 (88%) Frame = -3 Query: 220 VKKRGEAEQVKMIWITPSSCAKDLTISEGTGATFLFNFHSRVSM 89 +KK G+ QVKMIW+ PSSCAKDLTISEGTGATF FNFHSRVS+ Sbjct: 23 LKKEGKQNQVKMIWVAPSSCAKDLTISEGTGATFFFNFHSRVSI 66 >ref|NP_039435.1| hypothetical protein OrsajCp078 (plastid) [Oryza sativa Japonica Group] emb|CAA33944.1| unnamed protein product (chloroplast) [Oryza sativa Japonica Group] Length = 52 Score = 77.4 bits (189), Expect = 3e-15 Identities = 39/54 (72%), Positives = 41/54 (75%) Frame = -3 Query: 187 MIWITPSSCAKDLTISEGTGATFLFNFHSRVSMCFHAISFFEVSKKKKWTNSFS 26 MIW+ PSSCAKDLTISEGTGATFLFNFHSRVS F F + KWTNSFS Sbjct: 1 MIWVAPSSCAKDLTISEGTGATFLFNFHSRVSYLFPRP--FLRPRNMKWTNSFS 52 >gb|KJB14970.1| hypothetical protein B456_002G152100, partial [Gossypium raimondii] Length = 252 Score = 55.1 bits (131), Expect(2) = 7e-15 Identities = 26/34 (76%), Positives = 27/34 (79%) Frame = -3 Query: 451 RAFFSHYYG**NNGKNWIQLSTAPIGNWIDYGFE 350 +AF SHYYG NN K WIQLSTAPI N IDYGFE Sbjct: 175 KAFLSHYYGYENNRKIWIQLSTAPIRNKIDYGFE 208 Score = 53.9 bits (128), Expect(2) = 7e-15 Identities = 26/38 (68%), Positives = 28/38 (73%) Frame = -1 Query: 672 YPFSFDRCGGASQNRKTHIGFRDNQARTDDFHHVKVTL 559 YP + GA QNRKTHI FRDNQART+DFHHVK L Sbjct: 141 YPCASYLSRGAWQNRKTHIRFRDNQARTNDFHHVKAFL 178 >gb|AAO18644.1| hypothetical protein (chloroplast) [Lactuca sativa] gb|AAY57522.1| unknown (chloroplast) [Lactuca sativa] gb|PLY68380.1| hypothetical protein LSAT_7X380 [Lactuca sativa] Length = 99 Score = 64.7 bits (156), Expect(3) = 4e-14 Identities = 30/39 (76%), Positives = 34/39 (87%) Frame = +3 Query: 78 AWKHIETLEWKLKRNVAPVPSEMVRSLAQEEGVIHIILT 194 AWKHI TLEWK KR+ PVPSEMVRSLAQ++G+I IILT Sbjct: 40 AWKHIRTLEWKWKRDGTPVPSEMVRSLAQKKGLIRIILT 78 Score = 36.2 bits (82), Expect(3) = 4e-14 Identities = 17/23 (73%), Positives = 17/23 (73%) Frame = +2 Query: 188 LDLFCFPSFFNNTESGSSPTSIE 256 L FCF FFNNT SGSSPT IE Sbjct: 77 LTWFCFLYFFNNTGSGSSPTRIE 99 Score = 25.4 bits (54), Expect(3) = 4e-14 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +1 Query: 13 VCVPKKRNLSISFFLRPRKMKWR 81 VCVPKKRNL + R K W+ Sbjct: 23 VCVPKKRNL---YIFRDLKGAWK 42 >gb|OMP12403.1| ORF46h [Corchorus olitorius] Length = 64 Score = 73.6 bits (179), Expect = 1e-13 Identities = 34/43 (79%), Positives = 35/43 (81%) Frame = -1 Query: 681 QASYPFSFDRCGGASQNRKTHIGFRDNQARTDDFHHVKVTLYR 553 Q+ P D GGA QNRKTHIGFRDNQARTDDFHHVKVTLYR Sbjct: 22 QSHEPLIHDHGGGARQNRKTHIGFRDNQARTDDFHHVKVTLYR 64 >gb|PLY85626.1| hypothetical protein LSAT_0X40381 [Lactuca sativa] Length = 99 Score = 64.7 bits (156), Expect(3) = 2e-13 Identities = 30/39 (76%), Positives = 34/39 (87%) Frame = +3 Query: 78 AWKHIETLEWKLKRNVAPVPSEMVRSLAQEEGVIHIILT 194 AWKHI TLEWK KR+ PVPSEMVRSLAQ++G+I IILT Sbjct: 40 AWKHIRTLEWKWKRDGTPVPSEMVRSLAQKKGLIRIILT 78 Score = 33.9 bits (76), Expect(3) = 2e-13 Identities = 16/23 (69%), Positives = 16/23 (69%) Frame = +2 Query: 188 LDLFCFPSFFNNTESGSSPTSIE 256 L FCF FFNNT S SSPT IE Sbjct: 77 LTWFCFLYFFNNTGSASSPTRIE 99 Score = 25.4 bits (54), Expect(3) = 2e-13 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +1 Query: 13 VCVPKKRNLSISFFLRPRKMKWR 81 VCVPKKRNL + R K W+ Sbjct: 23 VCVPKKRNL---YIFRDLKGAWK 42