BLASTX nr result
ID: Ophiopogon23_contig00039868
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00039868 (439 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK56898.1| uncharacterized protein A4U43_C10F14420 [Asparagu... 65 3e-14 ref|XP_020248659.1| pentatricopeptide repeat-containing protein ... 65 3e-14 >gb|ONK56898.1| uncharacterized protein A4U43_C10F14420 [Asparagus officinalis] Length = 593 Score = 64.7 bits (156), Expect(2) = 3e-14 Identities = 34/50 (68%), Positives = 39/50 (78%) Frame = +2 Query: 290 EVEGEGDGAVVKVAEIGAEQVESVVSVLKGAAEEAIEVSLDKRELSLSEE 439 EVEG+GDGA V AEI E ++SVVS+LKG EEAIE SLDK E +LSEE Sbjct: 113 EVEGDGDGAQVATAEISPELIKSVVSILKGGEEEAIESSLDKLEPTLSEE 162 Score = 41.2 bits (95), Expect(2) = 3e-14 Identities = 28/70 (40%), Positives = 37/70 (52%) Frame = +1 Query: 79 NDAVDSTETSAWNFDGPDGSPIKLDDAGEDVDSSKTSAWNFEEPAVEVDKGDAFGEITEE 258 ++A D E S+W + P+GS + T W+ E+ DKG AFGEIT+E Sbjct: 62 DEAPDPGEASSWTPEEPEGS-------------NGTPPWDLED---HDDKGAAFGEITQE 105 Query: 259 SDDSSPRLEV 288 DSSP LEV Sbjct: 106 PADSSP-LEV 114 >ref|XP_020248659.1| pentatricopeptide repeat-containing protein At3g02650, mitochondrial [Asparagus officinalis] ref|XP_020248660.1| pentatricopeptide repeat-containing protein At3g02650, mitochondrial [Asparagus officinalis] Length = 579 Score = 64.7 bits (156), Expect(2) = 3e-14 Identities = 34/50 (68%), Positives = 39/50 (78%) Frame = +2 Query: 290 EVEGEGDGAVVKVAEIGAEQVESVVSVLKGAAEEAIEVSLDKRELSLSEE 439 EVEG+GDGA V AEI E ++SVVS+LKG EEAIE SLDK E +LSEE Sbjct: 113 EVEGDGDGAQVATAEISPELIKSVVSILKGGEEEAIESSLDKLEPTLSEE 162 Score = 41.2 bits (95), Expect(2) = 3e-14 Identities = 28/70 (40%), Positives = 37/70 (52%) Frame = +1 Query: 79 NDAVDSTETSAWNFDGPDGSPIKLDDAGEDVDSSKTSAWNFEEPAVEVDKGDAFGEITEE 258 ++A D E S+W + P+GS + T W+ E+ DKG AFGEIT+E Sbjct: 62 DEAPDPGEASSWTPEEPEGS-------------NGTPPWDLED---HDDKGAAFGEITQE 105 Query: 259 SDDSSPRLEV 288 DSSP LEV Sbjct: 106 PADSSP-LEV 114