BLASTX nr result
ID: Ophiopogon23_contig00036360
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00036360 (463 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020267060.1| uncharacterized protein LOC109842619 [Aspara... 79 3e-15 gb|ONK70542.1| uncharacterized protein A4U43_C05F34790 [Asparagu... 79 3e-15 ref|XP_020103144.1| uncharacterized protein LOC109720439 [Ananas... 60 2e-08 gb|OAY71956.1| F-BAR domain only protein 1, partial [Ananas como... 60 2e-08 ref|XP_010913657.1| PREDICTED: uncharacterized protein LOC105039... 62 2e-08 ref|XP_009394578.1| PREDICTED: uncharacterized protein LOC103980... 60 8e-08 emb|CBW30207.1| Conserved hypothetical protein [Musa balbisiana] 60 8e-08 emb|CBW30169.1| Conserved hypothetical protein [Musa balbisiana] 60 8e-08 ref|XP_008781899.1| PREDICTED: uncharacterized protein LOC103701... 60 1e-07 ref|XP_020699729.1| uncharacterized protein LOC110111997 [Dendro... 56 5e-07 gb|PKU65429.1| hypothetical protein MA16_Dca013574 [Dendrobium c... 56 5e-07 ref|XP_002445283.1| uncharacterized protein LOC8057881 [Sorghum ... 58 7e-07 ref|XP_004973059.1| uncharacterized protein LOC101770744 [Setari... 58 7e-07 ref|XP_010928658.1| PREDICTED: F-BAR domain only protein 1-like ... 58 9e-07 ref|XP_017698258.1| PREDICTED: F-BAR domain only protein 1-like ... 58 9e-07 gb|PAN34363.1| hypothetical protein PAHAL_J00824 [Panicum hallii] 57 2e-06 ref|XP_020590750.1| uncharacterized protein LOC110031730 [Phalae... 54 2e-06 ref|NP_001169733.1| uncharacterized protein LOC100383614 [Zea ma... 55 8e-06 >ref|XP_020267060.1| uncharacterized protein LOC109842619 [Asparagus officinalis] Length = 425 Score = 79.3 bits (194), Expect(2) = 3e-15 Identities = 37/43 (86%), Positives = 40/43 (93%) Frame = -2 Query: 462 PVEVDSGDSELEVYGTVKFAGQGALTLSGVHLRPVTDGIAHYS 334 PVEVDS + E+EVYGTVKFAGQGA TLSGVHLRPVTDGIAH+S Sbjct: 369 PVEVDSEEGEVEVYGTVKFAGQGAFTLSGVHLRPVTDGIAHFS 411 Score = 29.6 bits (65), Expect(2) = 3e-15 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = -3 Query: 305 HRYASGTYLCN 273 HRYASGTYLCN Sbjct: 415 HRYASGTYLCN 425 >gb|ONK70542.1| uncharacterized protein A4U43_C05F34790 [Asparagus officinalis] Length = 340 Score = 79.3 bits (194), Expect(2) = 3e-15 Identities = 37/43 (86%), Positives = 40/43 (93%) Frame = -2 Query: 462 PVEVDSGDSELEVYGTVKFAGQGALTLSGVHLRPVTDGIAHYS 334 PVEVDS + E+EVYGTVKFAGQGA TLSGVHLRPVTDGIAH+S Sbjct: 284 PVEVDSEEGEVEVYGTVKFAGQGAFTLSGVHLRPVTDGIAHFS 326 Score = 29.6 bits (65), Expect(2) = 3e-15 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = -3 Query: 305 HRYASGTYLCN 273 HRYASGTYLCN Sbjct: 330 HRYASGTYLCN 340 >ref|XP_020103144.1| uncharacterized protein LOC109720439 [Ananas comosus] Length = 662 Score = 60.5 bits (145), Expect(2) = 2e-08 Identities = 29/43 (67%), Positives = 35/43 (81%) Frame = -2 Query: 462 PVEVDSGDSELEVYGTVKFAGQGALTLSGVHLRPVTDGIAHYS 334 PV+ DS D ELEV G V+FA +GA TLSGV LRPV+DGIAH++ Sbjct: 606 PVDQDSQDGELEVVGMVEFAAKGANTLSGVSLRPVSDGIAHFN 648 Score = 25.4 bits (54), Expect(2) = 2e-08 Identities = 9/11 (81%), Positives = 9/11 (81%) Frame = -3 Query: 305 HRYASGTYLCN 273 H YASG YLCN Sbjct: 652 HTYASGVYLCN 662 >gb|OAY71956.1| F-BAR domain only protein 1, partial [Ananas comosus] Length = 512 Score = 60.5 bits (145), Expect(2) = 2e-08 Identities = 29/43 (67%), Positives = 35/43 (81%) Frame = -2 Query: 462 PVEVDSGDSELEVYGTVKFAGQGALTLSGVHLRPVTDGIAHYS 334 PV+ DS D ELEV G V+FA +GA TLSGV LRPV+DGIAH++ Sbjct: 456 PVDQDSQDGELEVVGMVEFAAKGANTLSGVSLRPVSDGIAHFN 498 Score = 25.4 bits (54), Expect(2) = 2e-08 Identities = 9/11 (81%), Positives = 9/11 (81%) Frame = -3 Query: 305 HRYASGTYLCN 273 H YASG YLCN Sbjct: 502 HTYASGVYLCN 512 >ref|XP_010913657.1| PREDICTED: uncharacterized protein LOC105039263 [Elaeis guineensis] Length = 654 Score = 62.4 bits (150), Expect = 2e-08 Identities = 28/43 (65%), Positives = 36/43 (83%) Frame = -2 Query: 462 PVEVDSGDSELEVYGTVKFAGQGALTLSGVHLRPVTDGIAHYS 334 PV+ DS D ELEV G VKF+ QG++TLSGV L+PV+DGIAH++ Sbjct: 598 PVDQDSADGELEVVGMVKFSAQGSITLSGVSLQPVSDGIAHFN 640 >ref|XP_009394578.1| PREDICTED: uncharacterized protein LOC103980014 [Musa acuminata subsp. malaccensis] Length = 655 Score = 59.7 bits (143), Expect(2) = 8e-08 Identities = 27/43 (62%), Positives = 35/43 (81%) Frame = -2 Query: 462 PVEVDSGDSELEVYGTVKFAGQGALTLSGVHLRPVTDGIAHYS 334 PV+ DS D EL+V G V F+ QG++TLSGV LRPV+DGIAH++ Sbjct: 599 PVDQDSADGELDVNGMVNFSSQGSMTLSGVCLRPVSDGIAHFN 641 Score = 24.3 bits (51), Expect(2) = 8e-08 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = -3 Query: 305 HRYASGTYLC 276 H YASGTYLC Sbjct: 645 HIYASGTYLC 654 >emb|CBW30207.1| Conserved hypothetical protein [Musa balbisiana] Length = 655 Score = 59.7 bits (143), Expect(2) = 8e-08 Identities = 27/43 (62%), Positives = 35/43 (81%) Frame = -2 Query: 462 PVEVDSGDSELEVYGTVKFAGQGALTLSGVHLRPVTDGIAHYS 334 PV+ DS D EL+V G V F+ QG++TLSGV LRPV+DGIAH++ Sbjct: 599 PVDQDSADGELDVNGMVNFSSQGSMTLSGVCLRPVSDGIAHFN 641 Score = 24.3 bits (51), Expect(2) = 8e-08 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = -3 Query: 305 HRYASGTYLC 276 H YASGTYLC Sbjct: 645 HIYASGTYLC 654 >emb|CBW30169.1| Conserved hypothetical protein [Musa balbisiana] Length = 655 Score = 59.7 bits (143), Expect(2) = 8e-08 Identities = 27/43 (62%), Positives = 35/43 (81%) Frame = -2 Query: 462 PVEVDSGDSELEVYGTVKFAGQGALTLSGVHLRPVTDGIAHYS 334 PV+ DS D EL+V G V F+ QG++TLSGV LRPV+DGIAH++ Sbjct: 599 PVDQDSADGELDVNGMVNFSSQGSMTLSGVCLRPVSDGIAHFN 641 Score = 24.3 bits (51), Expect(2) = 8e-08 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = -3 Query: 305 HRYASGTYLC 276 H YASGTYLC Sbjct: 645 HIYASGTYLC 654 >ref|XP_008781899.1| PREDICTED: uncharacterized protein LOC103701558 [Phoenix dactylifera] ref|XP_008781900.1| PREDICTED: uncharacterized protein LOC103701558 [Phoenix dactylifera] Length = 656 Score = 60.5 bits (145), Expect = 1e-07 Identities = 28/43 (65%), Positives = 34/43 (79%) Frame = -2 Query: 462 PVEVDSGDSELEVYGTVKFAGQGALTLSGVHLRPVTDGIAHYS 334 PV+ DS D ELEV G VKF+ QG TLSGV L+PV+DGIAH++ Sbjct: 600 PVDQDSADGELEVVGMVKFSAQGPTTLSGVSLQPVSDGIAHFN 642 >ref|XP_020699729.1| uncharacterized protein LOC110111997 [Dendrobium catenatum] Length = 655 Score = 55.8 bits (133), Expect(2) = 5e-07 Identities = 26/43 (60%), Positives = 34/43 (79%) Frame = -2 Query: 462 PVEVDSGDSELEVYGTVKFAGQGALTLSGVHLRPVTDGIAHYS 334 PV++DS + E+EV+ VKF+ QGALTLS V LRPV DGIA ++ Sbjct: 599 PVDLDSSEGEVEVHALVKFSSQGALTLSEVCLRPVADGIAQFN 641 Score = 25.4 bits (54), Expect(2) = 5e-07 Identities = 9/11 (81%), Positives = 9/11 (81%) Frame = -3 Query: 305 HRYASGTYLCN 273 H Y SGTYLCN Sbjct: 645 HTYQSGTYLCN 655 >gb|PKU65429.1| hypothetical protein MA16_Dca013574 [Dendrobium catenatum] Length = 645 Score = 55.8 bits (133), Expect(2) = 5e-07 Identities = 26/43 (60%), Positives = 34/43 (79%) Frame = -2 Query: 462 PVEVDSGDSELEVYGTVKFAGQGALTLSGVHLRPVTDGIAHYS 334 PV++DS + E+EV+ VKF+ QGALTLS V LRPV DGIA ++ Sbjct: 589 PVDLDSSEGEVEVHALVKFSSQGALTLSEVCLRPVADGIAQFN 631 Score = 25.4 bits (54), Expect(2) = 5e-07 Identities = 9/11 (81%), Positives = 9/11 (81%) Frame = -3 Query: 305 HRYASGTYLCN 273 H Y SGTYLCN Sbjct: 635 HTYQSGTYLCN 645 >ref|XP_002445283.1| uncharacterized protein LOC8057881 [Sorghum bicolor] gb|EES14778.1| hypothetical protein SORBI_3007G088900 [Sorghum bicolor] Length = 637 Score = 58.2 bits (139), Expect = 7e-07 Identities = 28/43 (65%), Positives = 32/43 (74%) Frame = -2 Query: 462 PVEVDSGDSELEVYGTVKFAGQGALTLSGVHLRPVTDGIAHYS 334 PV+ DS D ELEV G VKFA QG TLSG+ LRP TDGIA ++ Sbjct: 581 PVDQDSKDGELEVVGMVKFAYQGPFTLSGIKLRPATDGIAQFN 623 >ref|XP_004973059.1| uncharacterized protein LOC101770744 [Setaria italica] gb|KQL01120.1| hypothetical protein SETIT_013402mg [Setaria italica] Length = 640 Score = 58.2 bits (139), Expect = 7e-07 Identities = 28/43 (65%), Positives = 32/43 (74%) Frame = -2 Query: 462 PVEVDSGDSELEVYGTVKFAGQGALTLSGVHLRPVTDGIAHYS 334 PV+ DS D ELEV G VKFA QG TLSG+ LRP TDGIA ++ Sbjct: 584 PVDQDSKDGELEVLGMVKFAYQGPFTLSGIKLRPATDGIAQFN 626 >ref|XP_010928658.1| PREDICTED: F-BAR domain only protein 1-like [Elaeis guineensis] Length = 655 Score = 57.8 bits (138), Expect = 9e-07 Identities = 27/43 (62%), Positives = 34/43 (79%) Frame = -2 Query: 462 PVEVDSGDSELEVYGTVKFAGQGALTLSGVHLRPVTDGIAHYS 334 PV+ DS D ELEV G VKF+ QG+ TLSGV LRPV++GIA ++ Sbjct: 599 PVDQDSADGELEVVGMVKFSAQGSTTLSGVSLRPVSEGIADFN 641 >ref|XP_017698258.1| PREDICTED: F-BAR domain only protein 1-like [Phoenix dactylifera] Length = 657 Score = 57.8 bits (138), Expect = 9e-07 Identities = 27/43 (62%), Positives = 34/43 (79%) Frame = -2 Query: 462 PVEVDSGDSELEVYGTVKFAGQGALTLSGVHLRPVTDGIAHYS 334 PV+ DS D ELEV G VKF+ QG+ TLSGV LRPV++GIA ++ Sbjct: 601 PVDQDSADGELEVMGMVKFSAQGSTTLSGVSLRPVSEGIADFN 643 >gb|PAN34363.1| hypothetical protein PAHAL_J00824 [Panicum hallii] Length = 636 Score = 56.6 bits (135), Expect = 2e-06 Identities = 27/43 (62%), Positives = 32/43 (74%) Frame = -2 Query: 462 PVEVDSGDSELEVYGTVKFAGQGALTLSGVHLRPVTDGIAHYS 334 PV+ DS D ELEV G VKFA QG TLSG+ LRP T+GIA ++ Sbjct: 580 PVDQDSKDGELEVVGMVKFAYQGPFTLSGIKLRPATEGIAQFN 622 >ref|XP_020590750.1| uncharacterized protein LOC110031730 [Phalaenopsis equestris] Length = 649 Score = 54.3 bits (129), Expect(2) = 2e-06 Identities = 23/43 (53%), Positives = 35/43 (81%) Frame = -2 Query: 462 PVEVDSGDSELEVYGTVKFAGQGALTLSGVHLRPVTDGIAHYS 334 PV+ DS + E+EV+ +VKF+ QGA+TLS V LRP++DG+A ++ Sbjct: 593 PVDQDSSEGEVEVHASVKFSSQGAMTLSEVCLRPISDGVAQFN 635 Score = 24.6 bits (52), Expect(2) = 2e-06 Identities = 9/11 (81%), Positives = 9/11 (81%) Frame = -3 Query: 305 HRYASGTYLCN 273 H Y SGTYLCN Sbjct: 639 HIYESGTYLCN 649 >ref|NP_001169733.1| uncharacterized protein LOC100383614 [Zea mays] gb|ACN34706.1| unknown [Zea mays] gb|AQK41148.1| hypothetical protein ZEAMMB73_Zm00001d024416 [Zea mays] Length = 637 Score = 55.1 bits (131), Expect = 8e-06 Identities = 27/43 (62%), Positives = 31/43 (72%) Frame = -2 Query: 462 PVEVDSGDSELEVYGTVKFAGQGALTLSGVHLRPVTDGIAHYS 334 PV+ DS D ELEV G VKFA QG TLSG+ L P TDGIA ++ Sbjct: 581 PVDQDSKDGELEVVGMVKFAYQGPFTLSGIKLCPATDGIAQFN 623