BLASTX nr result
ID: Ophiopogon23_contig00035680
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00035680 (957 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AKJ77609.1| Ycf15 (chloroplast) [Dioscorea nipponica] 175 2e-51 gb|AKJ77604.1| Ycf15 (chloroplast) [Dioscorea nipponica] 130 1e-34 gb|AKF01116.1| hypothetical chloroplast RF15 (chloroplast) [Bact... 123 1e-31 gb|AKF01040.1| hypothetical chloroplast RF15 (chloroplast) [Atta... 122 4e-31 gb|AKF00542.1| hypothetical chloroplast RF15 (chloroplast) [Roys... 118 9e-30 ref|YP_004891653.1| unnamed protein product (chloroplast) [Nicot... 61 2e-24 ref|YP_009040365.1| hypothetical protein [Hyoscyamus niger] >gi|... 61 3e-24 ref|YP_008239213.1| hypothetical chloroplast RF15 (chloroplast) ... 105 3e-24 ref|YP_008239136.1| hypothetical chloroplast RF15 (chloroplast) ... 105 3e-24 ref|YP_009469484.1| Ycf15 (chloroplast) [Anemoclema glaucifolium... 92 4e-23 ref|YP_009269888.1| hypothetical chloroplast RF15 (chloroplast) ... 99 7e-23 ref|NP_043074.1| hypothetical protein ZemaCp073 (chloroplast) [Z... 100 1e-22 gb|KQJ95764.1| hypothetical protein BRADI_3g18883v3, partial [Br... 98 7e-22 ref|YP_009245295.1| ycf15 (chloroplast) [Eriochrysis cf. cayenne... 98 8e-22 ref|XP_013443676.1| ycf15 protein, putative [Medicago truncatula... 100 1e-21 gb|KQJ86849.1| hypothetical protein BRADI_4g08051v3, partial [Br... 97 1e-21 gb|ACI43242.1| unknown (chloroplast) [Coix lacryma-jobi] >gi|209... 97 2e-21 gb|PNT67434.1| hypothetical protein BRADI_3g27344v3, partial [Br... 95 4e-21 gb|PHT97076.1| hypothetical protein BC332_33997 [Capsicum chinense] 56 6e-21 ref|YP_009269692.1| hypothetical chloroplast RF15 (chloroplast) ... 93 2e-20 >gb|AKJ77609.1| Ycf15 (chloroplast) [Dioscorea nipponica] Length = 126 Score = 175 bits (443), Expect = 2e-51 Identities = 99/153 (64%), Positives = 100/153 (65%), Gaps = 2/153 (1%) Frame = -1 Query: 660 IFTTKRYWILFRIGPERRRKAGMPTGVCLFSNSPDPIVPILGTSSAKVTE*VSRQSLKRT 481 IFTTKRYWILFRIGPERRR+AGMPT VCLFSNSPDPIVPI GTSSAKVTE VSRQSLKR Sbjct: 20 IFTTKRYWILFRIGPERRREAGMPTDVCLFSNSPDPIVPIFGTSSAKVTEWVSRQSLKR- 78 Query: 480 M*CTLSAGLRVLVGILLEVSINLPLCDSC*IIYSGGGAGRTISKRTPHSLDREDRQDFVI 301 TPHSLDREDRQDFVI Sbjct: 79 ---------------------------------------------TPHSLDREDRQDFVI 93 Query: 300 CCRTY--SNSLDSDRGDRRNTSYQQIRYSVYQY 208 CRTY SNS DSDRGDRRNTSYQQIRYSVYQY Sbjct: 94 RCRTYSNSNSPDSDRGDRRNTSYQQIRYSVYQY 126 >gb|AKJ77604.1| Ycf15 (chloroplast) [Dioscorea nipponica] Length = 85 Score = 130 bits (328), Expect = 1e-34 Identities = 78/131 (59%), Positives = 78/131 (59%), Gaps = 2/131 (1%) Frame = -1 Query: 594 MPTGVCLFSNSPDPIVPILGTSSAKVTE*VSRQSLKRTM*CTLSAGLRVLVGILLEVSIN 415 MPT VCLFSNSPDPIVPI GTSSAKVTE VSRQSLK Sbjct: 1 MPTDVCLFSNSPDPIVPIFGTSSAKVTEWVSRQSLK------------------------ 36 Query: 414 LPLCDSC*IIYSGGGAGRTISKRTPHSLDREDRQDFVICCRTY--SNSLDSDRGDRRNTS 241 RTPHSLDREDRQDFVI CRTY SNS DSDRGDRRNTS Sbjct: 37 ----------------------RTPHSLDREDRQDFVIRCRTYSNSNSPDSDRGDRRNTS 74 Query: 240 YQQIRYSVYQY 208 YQQIRYSVYQY Sbjct: 75 YQQIRYSVYQY 85 >gb|AKF01116.1| hypothetical chloroplast RF15 (chloroplast) [Bactris major] gb|AKF01189.1| hypothetical chloroplast RF15 (chloroplast) [Beccariophoenix madagascariensis] gb|AKF01208.1| hypothetical chloroplast RF15 (chloroplast) [Beccariophoenix madagascariensis] Length = 107 Score = 123 bits (309), Expect = 1e-31 Identities = 61/64 (95%), Positives = 61/64 (95%) Frame = -1 Query: 675 VHPIQIFTTKRYWILFRIGPERRRKAGMPTGVCLFSNSPDPIVPILGTSSAKVTE*VSRQ 496 V PIQIFTTKRYWILFRIGPERRRKAGMPT VCLFSNSPDPIVPILGTSSAKVTE VSRQ Sbjct: 20 VRPIQIFTTKRYWILFRIGPERRRKAGMPTDVCLFSNSPDPIVPILGTSSAKVTEWVSRQ 79 Query: 495 SLKR 484 SLKR Sbjct: 80 SLKR 83 >gb|AKF01040.1| hypothetical chloroplast RF15 (chloroplast) [Attalea speciosa] gb|AOX12842.1| hypothetical chloroplast RF15 (chloroplast) [Cocos nucifera] gb|AOX12863.1| hypothetical chloroplast RF15 (chloroplast) [Cocos nucifera] Length = 107 Score = 122 bits (306), Expect = 4e-31 Identities = 60/64 (93%), Positives = 61/64 (95%) Frame = -1 Query: 675 VHPIQIFTTKRYWILFRIGPERRRKAGMPTGVCLFSNSPDPIVPILGTSSAKVTE*VSRQ 496 V PIQIFTTKRYWILFRIGPERRR+AGMPT VCLFSNSPDPIVPILGTSSAKVTE VSRQ Sbjct: 20 VRPIQIFTTKRYWILFRIGPERRRRAGMPTDVCLFSNSPDPIVPILGTSSAKVTEWVSRQ 79 Query: 495 SLKR 484 SLKR Sbjct: 80 SLKR 83 >gb|AKF00542.1| hypothetical chloroplast RF15 (chloroplast) [Roystonea regia] Length = 85 Score = 118 bits (295), Expect = 9e-30 Identities = 58/61 (95%), Positives = 59/61 (96%) Frame = -1 Query: 666 IQIFTTKRYWILFRIGPERRRKAGMPTGVCLFSNSPDPIVPILGTSSAKVTE*VSRQSLK 487 +QIFTTKRYWILFRIGPERRRKAGMPT VCLFSNSPDPIVPILGTSSAKVTE VSRQSLK Sbjct: 1 MQIFTTKRYWILFRIGPERRRKAGMPTDVCLFSNSPDPIVPILGTSSAKVTEWVSRQSLK 60 Query: 486 R 484 R Sbjct: 61 R 61 >ref|YP_004891653.1| unnamed protein product (chloroplast) [Nicotiana undulata] ref|YP_004891682.1| unnamed protein product (chloroplast) [Nicotiana undulata] emb|CAA77388.1| hypothetical protein (chloroplast) [Nicotiana tabacum] emb|CAA77405.1| hypothetical protein (chloroplast) [Nicotiana tabacum] dbj|BAE46700.1| hypothetical protein (chloroplast) [Nicotiana sylvestris] dbj|BAE46730.1| hypothetical protein (chloroplast) [Nicotiana sylvestris] dbj|BAE48049.1| hypothetical protein (chloroplast) [Nicotiana tomentosiformis] dbj|BAE48079.1| hypothetical protein (chloroplast) [Nicotiana tomentosiformis] gb|AEO95591.1| hypothetical protein (chloroplast) [Nicotiana undulata] gb|AEO95639.1| hypothetical protein (chloroplast) [Nicotiana undulata] gb|AEO95701.1| hypothetical protein [synthetic construct] gb|AEO95747.1| hypothetical protein [synthetic construct] prf||1211235CC ORF 115 Length = 115 Score = 61.2 bits (147), Expect(3) = 2e-24 Identities = 30/39 (76%), Positives = 34/39 (87%) Frame = +2 Query: 371 PPPEYMIQQESHRGRLIETSSKIPTSTRNPADKVHYIVR 487 PPPEYM+QQESH+GRL ETS K+P RNPADKVHYIV+ Sbjct: 55 PPPEYMLQQESHKGRL-ETSGKMP--ARNPADKVHYIVQ 90 Score = 56.6 bits (135), Expect(3) = 2e-24 Identities = 28/39 (71%), Positives = 29/39 (74%) Frame = +3 Query: 264 DPSPSCWNRFGSRSRNLGDLLYLMNEESVWKSSAPRHPP 380 DPS WN+FGS SRNLGDLLYLMN ES KSSA PP Sbjct: 19 DPSSWNWNKFGSGSRNLGDLLYLMNGESALKSSALHPPP 57 Score = 44.3 bits (103), Expect(3) = 2e-24 Identities = 20/22 (90%), Positives = 20/22 (90%) Frame = +1 Query: 493 GLATYSFSDFGTGRSQNGYYRV 558 GLATY FSDFGTGRSQNG YRV Sbjct: 91 GLATYPFSDFGTGRSQNGDYRV 112 >ref|YP_009040365.1| hypothetical protein [Hyoscyamus niger] gb|AGU46513.1| hypothetical protein (plastid) [Hyoscyamus niger] Length = 115 Score = 60.8 bits (146), Expect(3) = 3e-24 Identities = 30/38 (78%), Positives = 33/38 (86%) Frame = +2 Query: 371 PPPEYMIQQESHRGRLIETSSKIPTSTRNPADKVHYIV 484 PPPEYM+QQESH+GRL ETS K+P RNPADKVHYIV Sbjct: 55 PPPEYMLQQESHKGRL-ETSGKMP--ARNPADKVHYIV 89 Score = 56.6 bits (135), Expect(3) = 3e-24 Identities = 28/39 (71%), Positives = 29/39 (74%) Frame = +3 Query: 264 DPSPSCWNRFGSRSRNLGDLLYLMNEESVWKSSAPRHPP 380 DPS WN+FGS SRNLGDLLYLMN ES KSSA PP Sbjct: 19 DPSSWNWNKFGSGSRNLGDLLYLMNGESALKSSALHPPP 57 Score = 44.3 bits (103), Expect(3) = 3e-24 Identities = 20/22 (90%), Positives = 20/22 (90%) Frame = +1 Query: 493 GLATYSFSDFGTGRSQNGYYRV 558 GLATY FSDFGTGRSQNG YRV Sbjct: 91 GLATYPFSDFGTGRSQNGDYRV 112 >ref|YP_008239213.1| hypothetical chloroplast RF15 (chloroplast) [Secale cereale] gb|AGP51110.1| hypothetical chloroplast RF15 (chloroplast) [Secale cereale] Length = 132 Score = 105 bits (261), Expect = 3e-24 Identities = 51/61 (83%), Positives = 53/61 (86%) Frame = -1 Query: 675 VHPIQIFTTKRYWILFRIGPERRRKAGMPTGVCLFSNSPDPIVPILGTSSAKVTE*VSRQ 496 V PI IF TKRYWILFRIGPERRRKA MPT +CLFSNSPDPIVP+ GTSSAKVTE VS Q Sbjct: 46 VRPILIFRTKRYWILFRIGPERRRKAEMPTDLCLFSNSPDPIVPVFGTSSAKVTEWVSHQ 105 Query: 495 S 493 S Sbjct: 106 S 106 >ref|YP_008239136.1| hypothetical chloroplast RF15 (chloroplast) [Triticum monococcum] ref|YP_008474343.1| hypothetical chloroplast RF15 (chloroplast) [Aegilops tauschii] ref|YP_008474434.1| hypothetical chloroplast RF15 (chloroplast) [Aegilops speltoides] ref|YP_008963948.1| hypothetical chloroplast RF15 (chloroplast) [Aegilops geniculata] ref|YP_008963869.1| hypothetical chloroplast RF15 (chloroplast) [Aegilops cylindrica] gb|AFH89553.1| hypothetical chloroplast RF15 (chloroplast) [Aegilops tauschii] gb|AFN42416.1| hypothetical chloroplast RF15 (chloroplast) [Aegilops speltoides] gb|AGP50797.1| hypothetical chloroplast RF15 (chloroplast) [Hordeum vulgare subsp. vulgare] gb|AGP50874.1| hypothetical chloroplast RF15 (chloroplast) [Hordeum vulgare subsp. spontaneum] gb|AGP50954.1| hypothetical chloroplast RF15 (chloroplast) [Hordeum vulgare subsp. spontaneum] gb|AGP51034.1| hypothetical chloroplast RF15 (chloroplast) [Triticum monococcum] gb|AGP51189.1| hypothetical chloroplast RF15 (chloroplast) [Triticum monococcum subsp. aegilopoides] gb|AGP51326.1| hypothetical chloroplast RF2 (chloroplast) [Triticum aestivum] gb|AGY92899.1| hypothetical chloroplast RF15 (chloroplast) [Aegilops cylindrica] gb|AGY92978.1| hypothetical chloroplast RF15 (chloroplast) [Aegilops geniculata] Length = 132 Score = 105 bits (261), Expect = 3e-24 Identities = 51/61 (83%), Positives = 53/61 (86%) Frame = -1 Query: 675 VHPIQIFTTKRYWILFRIGPERRRKAGMPTGVCLFSNSPDPIVPILGTSSAKVTE*VSRQ 496 V PI IF TKRYWILFRIGPERRRKA MPT +CLFSNSPDPIVP+ GTSSAKVTE VS Q Sbjct: 46 VRPILIFRTKRYWILFRIGPERRRKAEMPTDLCLFSNSPDPIVPVFGTSSAKVTEWVSHQ 105 Query: 495 S 493 S Sbjct: 106 S 106 >ref|YP_009469484.1| Ycf15 (chloroplast) [Anemoclema glaucifolium] ref|YP_009469501.1| Ycf15 (chloroplast) [Anemoclema glaucifolium] gb|AVD96771.1| Ycf15 (chloroplast) [Anemoclema glaucifolium] gb|AVD96772.1| Ycf15 (chloroplast) [Anemoclema glaucifolium] Length = 112 Score = 92.4 bits (228), Expect(3) = 4e-23 Identities = 54/75 (72%), Positives = 59/75 (78%), Gaps = 4/75 (5%) Frame = -1 Query: 441 GILLEVSI-NLPLCDSC*IIYSGG-GAGRTISKRTPHSLDREDRQDFVICCRTYSNSL-- 274 GIL EVSI ++ C +Y+ G GAGRTISK TPHSLDRE RQDFVICCRTYSNS Sbjct: 25 GILPEVSIVSIYPCVIPVEVYTRGVGAGRTISKWTPHSLDREGRQDFVICCRTYSNSKRP 84 Query: 273 DSDRGDRRNTSYQQI 229 DSDRGDRRN+SYQQI Sbjct: 85 DSDRGDRRNSSYQQI 99 Score = 39.7 bits (91), Expect(3) = 4e-23 Identities = 16/19 (84%), Positives = 17/19 (89%) Frame = -3 Query: 511 MSKSPIPKTDYVMYFIRWV 455 M KSP+PKTDYVMYFI WV Sbjct: 1 MGKSPLPKTDYVMYFICWV 19 Score = 25.8 bits (55), Expect(3) = 4e-23 Identities = 13/18 (72%), Positives = 14/18 (77%) Frame = -3 Query: 238 STDKILGISILIRSEICY 185 S +ILGISI IRSEI Y Sbjct: 95 SYQQILGISISIRSEISY 112 >ref|YP_009269888.1| hypothetical chloroplast RF15 (chloroplast) [Epipactis veratrifolia] ref|YP_009269905.1| hypothetical chloroplast RF15 (chloroplast) [Epipactis veratrifolia] gb|ANT72796.1| hypothetical chloroplast RF15 (chloroplast) [Epipactis veratrifolia] gb|ANT72814.1| hypothetical chloroplast RF15 (chloroplast) [Epipactis veratrifolia] Length = 80 Score = 99.0 bits (245), Expect(3) = 7e-23 Identities = 51/60 (85%), Positives = 53/60 (88%) Frame = -1 Query: 657 FTTKRYWILFRIGPERRRKAGMPTGVCLFSNSPDPIVPILGTSSAKVTE*VSRQSLKRTM 478 ++ R ILFRIGPERRRKAGMPT VCLFSNSPDPIVPIL TSSAKVTE VSRQSLKRTM Sbjct: 21 YSRPRGTILFRIGPERRRKAGMPTDVCLFSNSPDPIVPILRTSSAKVTEWVSRQSLKRTM 80 Score = 29.3 bits (64), Expect(3) = 7e-23 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -3 Query: 718 ILIVLFRSKDIHVGG 674 +LIVLFRSKDIH GG Sbjct: 1 MLIVLFRSKDIHGGG 15 Score = 28.9 bits (63), Expect(3) = 7e-23 Identities = 11/12 (91%), Positives = 12/12 (100%) Frame = -2 Query: 674 FILFRYSRPRGT 639 F+LFRYSRPRGT Sbjct: 16 FVLFRYSRPRGT 27 >ref|NP_043074.1| hypothetical protein ZemaCp073 (chloroplast) [Zea mays] ref|NP_043104.1| hypothetical protein ZemaCp103 (chloroplast) [Zea mays] ref|YP_024326.1| hypothetical protein PS017 [Saccharum hybrid cultivar SP-80-3280] ref|YP_024354.1| hypothetical protein PS069 [Saccharum hybrid cultivar SP-80-3280] ref|YP_054680.1| hypothetical protein SaofCp074 (chloroplast) [Saccharum hybrid cultivar NCo 310] ref|YP_054713.1| hypothetical protein SaofCp107 (chloroplast) [Saccharum hybrid cultivar NCo 310] ref|YP_009192458.1| hypothetical protein MsaCp_p075 (chloroplast) [Miscanthus sacchariflorus] ref|YP_009192495.1| hypothetical protein MsaCp_p112 (chloroplast) [Miscanthus sacchariflorus] ref|YP_009192580.1| hypothetical protein MsiCp_p075 (chloroplast) [Miscanthus sinensis] ref|YP_009192617.1| hypothetical protein MsiCp_p112 (chloroplast) [Miscanthus sinensis] ref|YP_009240086.1| hypothetical chloroplast RF15 (plastid) [Panicum miliaceum] ref|YP_009240105.1| hypothetical chloroplast RF15 (plastid) [Panicum miliaceum] ref|YP_009245464.1| ycf15 (chloroplast) [Chrysopogon serrulatus] ref|YP_009245481.1| ycf15 (chloroplast) [Chrysopogon serrulatus] ref|YP_009271710.1| hypothetical chloroplast RF15 (chloroplast) [Saccharum arundinaceum] ref|YP_009271729.1| hypothetical chloroplast RF15 (chloroplast) [Saccharum arundinaceum] ref|YP_009332191.1| Ycf15 (chloroplast) [Panicum sumatrense] ref|YP_009332208.1| Ycf15 (chloroplast) [Panicum sumatrense] ref|YP_009389617.1| hypothetical chloroplast RF15 (chloroplast) [Saccharum officinarum] ref|YP_009389648.1| hypothetical chloroplast RF15 (chloroplast) [Saccharum officinarum] ref|YP_009421788.1| hypothetical chloroplast RF15 (chloroplast) [Miscanthus floridulus] ref|YP_009421819.1| hypothetical chloroplast RF15 (chloroplast) [Miscanthus floridulus] ref|YP_009421894.1| hypothetical chloroplast RF15 (chloroplast) [Miscanthus junceus] ref|YP_009421925.1| hypothetical chloroplast RF15 (chloroplast) [Miscanthus junceus] ref|YP_009422000.1| hypothetical chloroplast RF15 (chloroplast) [Miscanthus transmorrisonensis] ref|YP_009422031.1| hypothetical chloroplast RF15 (chloroplast) [Miscanthus transmorrisonensis] ref|YP_009422106.1| hypothetical chloroplast RF15 (chloroplast) [Miscanthus x giganteus] ref|YP_009422137.1| hypothetical chloroplast RF15 (chloroplast) [Miscanthus x giganteus] sp|P46666.1|YCF15_MAIZE PUTATIVE PSEUDOGENE: RecName: Full=Putative uncharacterized protein ycf15; AltName: Full=ORF 99 sp|Q6ENR3.1|YCF15_SACOF PUTATIVE PSEUDOGENE: RecName: Full=Putative uncharacterized protein ycf15; AltName: Full=ORF99 sp|Q6L3C4.1|YCF15_SACHY RecName: Full=Putative uncharacterized protein ycf15 emb|CAA60336.1| hypothetical protein (chloroplast) [Zea mays] emb|CAA60365.1| hypothetical protein (chloroplast) [Zea mays] gb|AAT44641.1| hypothetical protein PS017 (chloroplast) [Saccharum hybrid cultivar SP80-3280] gb|AAT44668.1| unknown (chloroplast) [Saccharum hybrid cultivar SP80-3280] dbj|BAD27343.1| hypothetical protein (chloroplast) [Saccharum hybrid cultivar NCo 310] dbj|BAD27377.1| hypothetical protein (chloroplast) [Saccharum hybrid cultivar NCo 310] gb|AHV90369.1| hypothetical chloroplast RF15 (chloroplast) [Setaria italica] gb|AHV90388.1| hypothetical chloroplast RF15 (chloroplast) [Setaria italica] gb|ALP29685.1| hypothetical protein MsaCp_p075 (chloroplast) [Miscanthus sacchariflorus] gb|ALP29722.1| hypothetical protein MsaCp_p112 (chloroplast) [Miscanthus sacchariflorus] gb|ALP29807.1| hypothetical protein MsiCp_p075 (chloroplast) [Miscanthus sinensis] gb|ALP29844.1| hypothetical protein MsiCp_p112 (chloroplast) [Miscanthus sinensis] gb|AMN87236.1| hypothetical chloroplast RF15 (plastid) [Panicum miliaceum] gb|AMN87255.1| hypothetical chloroplast RF15 (plastid) [Panicum miliaceum] gb|AMR98047.1| ycf15 (chloroplast) [Chrysopogon serrulatus] gb|AMR98064.1| ycf15 (chloroplast) [Chrysopogon serrulatus] dbj|BAV38295.1| hypothetical chloroplast RF15 (chloroplast) [Saccharum arundinaceum] dbj|BAV38315.1| hypothetical chloroplast RF15 (chloroplast) [Saccharum arundinaceum] dbj|BAV38382.1| hypothetical chloroplast RF15 (chloroplast) [Miscanthus sinensis] dbj|BAV38400.1| hypothetical chloroplast RF15 (chloroplast) [Miscanthus sinensis] gb|AOD27724.1| putative uncharacterized protein ycf15 (chloroplast) [Saccharum hybrid cultivar RB867515] gb|AOD27744.1| putative uncharacterized protein ycf15 (chloroplast) [Saccharum hybrid cultivar RB867515] gb|APH82158.1| Ycf15 (chloroplast) [Panicum sumatrense] gb|APH82175.1| Ycf15 (chloroplast) [Panicum sumatrense] gb|ARS74330.1| ycf15 (chloroplast) [Chrysopogon zizanioides] gb|ARS74349.1| ycf15 (chloroplast) [Chrysopogon zizanioides] gb|ARS74416.1| ycf15 (chloroplast) [Chrysopogon zizanioides] gb|ARS74435.1| ycf15 (chloroplast) [Chrysopogon zizanioides] emb|CRK62358.1| hypothetical chloroplast RF15 (chloroplast) [Saccharum spontaneum] emb|CRK62390.1| hypothetical chloroplast RF15 (chloroplast) [Saccharum spontaneum] emb|CRK62586.1| hypothetical chloroplast RF15 (chloroplast) [Saccharum officinarum] emb|CRK62618.1| hypothetical chloroplast RF15 (chloroplast) [Saccharum officinarum] emb|CRK62477.1| hypothetical chloroplast RF15 (chloroplast) [Saccharum hybrid cultivar] emb|CRK62509.1| hypothetical chloroplast RF15 (chloroplast) [Saccharum hybrid cultivar] emb|CRY90712.1| hypothetical chloroplast RF15 (chloroplast) [Miscanthus floridulus] emb|CRY90744.1| hypothetical chloroplast RF15 (chloroplast) [Miscanthus floridulus] emb|CRY89078.1| hypothetical chloroplast RF15 (chloroplast) [Miscanthus junceus] emb|CRY89110.1| hypothetical chloroplast RF15 (chloroplast) [Miscanthus junceus] emb|CRY89187.1| hypothetical chloroplast RF15 (chloroplast) [Miscanthus sacchariflorus] emb|CRY89219.1| hypothetical chloroplast RF15 (chloroplast) [Miscanthus sacchariflorus] emb|CRY89296.1| hypothetical chloroplast RF15 (chloroplast) [Miscanthus sacchariflorus] emb|CRY89328.1| hypothetical chloroplast RF15 (chloroplast) [Miscanthus sacchariflorus] emb|CRY89405.1| hypothetical chloroplast RF15 (chloroplast) [Miscanthus sacchariflorus] emb|CRY89437.1| hypothetical chloroplast RF15 (chloroplast) [Miscanthus sacchariflorus] emb|CRY89514.1| hypothetical chloroplast RF15 (chloroplast) [Miscanthus sinensis subsp. condensatus] emb|CRY89546.1| hypothetical chloroplast RF15 (chloroplast) [Miscanthus sinensis subsp. condensatus] emb|CRY89623.1| hypothetical chloroplast RF15 (chloroplast) [Miscanthus sinensis subsp. sinensis] emb|CRY89655.1| hypothetical chloroplast RF15 (chloroplast) [Miscanthus sinensis subsp. sinensis] emb|CRY89732.1| hypothetical chloroplast RF15 (chloroplast) [Miscanthus sinensis subsp. sinensis] emb|CRY89764.1| hypothetical chloroplast RF15 (chloroplast) [Miscanthus sinensis subsp. sinensis] emb|CRY89841.1| hypothetical chloroplast RF15 (chloroplast) [Miscanthus sinensis subsp. sinensis] emb|CRY89873.1| hypothetical chloroplast RF15 (chloroplast) [Miscanthus sinensis subsp. sinensis] emb|CRY89950.1| hypothetical chloroplast RF15 (chloroplast) [Miscanthus sinensis var. purpurascens] emb|CRY89982.1| hypothetical chloroplast RF15 (chloroplast) [Miscanthus sinensis var. purpurascens] emb|CRY90059.1| hypothetical chloroplast RF15 (chloroplast) [Miscanthus sinensis subsp. sinensis] emb|CRY90091.1| hypothetical chloroplast RF15 (chloroplast) [Miscanthus sinensis subsp. sinensis] emb|CRY90168.1| hypothetical chloroplast RF15 (chloroplast) [Miscanthus sinensis subsp. sinensis] emb|CRY90200.1| hypothetical chloroplast RF15 (chloroplast) [Miscanthus sinensis subsp. sinensis] emb|CRY90277.1| hypothetical chloroplast RF15 (chloroplast) [Miscanthus sinensis subsp. sinensis] emb|CRY90309.1| hypothetical chloroplast RF15 (chloroplast) [Miscanthus sinensis subsp. sinensis] emb|CRY90385.1| hypothetical chloroplast RF15 (chloroplast) [Miscanthus sinensis subsp. sinensis] emb|CRY90417.1| hypothetical chloroplast RF15 (chloroplast) [Miscanthus sinensis subsp. sinensis] emb|CRY90494.1| hypothetical chloroplast RF15 (chloroplast) [Miscanthus transmorrisonensis] emb|CRY90526.1| hypothetical chloroplast RF15 (chloroplast) [Miscanthus transmorrisonensis] emb|CRY90603.1| hypothetical chloroplast RF15 (chloroplast) [Miscanthus x giganteus] emb|CRY90635.1| hypothetical chloroplast RF15 (chloroplast) [Miscanthus x giganteus] gb|ASV52297.1| hypothetical protein (chloroplast) [Saccharum officinarum] gb|ASV52330.1| hypothetical protein (chloroplast) [Saccharum officinarum] emb|CUS18930.1| hypothetical chloroplast RF15 (plastid) [Miscanthus sinensis subsp. sinensis] emb|CUS18963.1| hypothetical chloroplast RF15 (plastid) [Miscanthus sinensis subsp. sinensis] emb|CUS19196.1| hypothetical chloroplast RF15 (chloroplast) [Saccharum hybrid cultivar] emb|CUS19229.1| hypothetical chloroplast RF15 (chloroplast) [Saccharum hybrid cultivar] emb|CUS19089.1| hypothetical chloroplast RF15 (chloroplast) [Saccharum spontaneum] emb|CUS19122.1| hypothetical chloroplast RF15 (chloroplast) [Saccharum spontaneum] Length = 99 Score = 100 bits (248), Expect = 1e-22 Identities = 49/61 (80%), Positives = 52/61 (85%) Frame = -1 Query: 675 VHPIQIFTTKRYWILFRIGPERRRKAGMPTGVCLFSNSPDPIVPILGTSSAKVTE*VSRQ 496 V PI IF TKR WILFRIGPERRR+A MPT +CLFSNSPDPIVP+ GTSSAKVTE VS Q Sbjct: 17 VRPILIFRTKRSWILFRIGPERRREAEMPTDLCLFSNSPDPIVPVFGTSSAKVTEWVSHQ 76 Query: 495 S 493 S Sbjct: 77 S 77 >gb|KQJ95764.1| hypothetical protein BRADI_3g18883v3, partial [Brachypodium distachyon] Length = 96 Score = 97.8 bits (242), Expect = 7e-22 Identities = 48/61 (78%), Positives = 51/61 (83%) Frame = -1 Query: 675 VHPIQIFTTKRYWILFRIGPERRRKAGMPTGVCLFSNSPDPIVPILGTSSAKVTE*VSRQ 496 V PI IF TKRYWILFRIGPERRRKA MPT + LFSNSP+PIVP+ GTS AKVTE VS Q Sbjct: 14 VRPILIFRTKRYWILFRIGPERRRKAEMPTDLYLFSNSPEPIVPVFGTSGAKVTEWVSHQ 73 Query: 495 S 493 S Sbjct: 74 S 74 >ref|YP_009245295.1| ycf15 (chloroplast) [Eriochrysis cf. cayennensis 365-2] ref|YP_009245312.1| ycf15 (chloroplast) [Eriochrysis cf. cayennensis 365-2] ref|YP_009245380.1| ycf15 (chloroplast) [Eriochrysis laxa] ref|YP_009245397.1| ycf15 (chloroplast) [Eriochrysis laxa] gb|AMR97708.1| ycf15 (chloroplast) [Eriochrysis villosa] gb|AMR97725.1| ycf15 (chloroplast) [Eriochrysis villosa] gb|AMR97793.1| ycf15 (chloroplast) [Eriochrysis cayennensis] gb|AMR97810.1| ycf15 (chloroplast) [Eriochrysis cayennensis] gb|AMR97878.1| ycf15 (chloroplast) [Eriochrysis cf. cayennensis 365-2] gb|AMR97895.1| ycf15 (chloroplast) [Eriochrysis cf. cayennensis 365-2] gb|AMR97963.1| ycf15 (chloroplast) [Eriochrysis laxa] gb|AMR97980.1| ycf15 (chloroplast) [Eriochrysis laxa] Length = 99 Score = 97.8 bits (242), Expect = 8e-22 Identities = 48/61 (78%), Positives = 51/61 (83%) Frame = -1 Query: 675 VHPIQIFTTKRYWILFRIGPERRRKAGMPTGVCLFSNSPDPIVPILGTSSAKVTE*VSRQ 496 V PI IF TKR WILFRIGPERRR+A MP +CLFSNSPDPIVP+ GTSSAKVTE VS Q Sbjct: 17 VRPILIFRTKRSWILFRIGPERRREAEMPMDLCLFSNSPDPIVPVFGTSSAKVTEWVSHQ 76 Query: 495 S 493 S Sbjct: 77 S 77 >ref|XP_013443676.1| ycf15 protein, putative [Medicago truncatula] gb|KEH17701.1| ycf15 protein, putative [Medicago truncatula] Length = 194 Score = 100 bits (248), Expect = 1e-21 Identities = 47/55 (85%), Positives = 49/55 (89%) Frame = -1 Query: 675 VHPIQIFTTKRYWILFRIGPERRRKAGMPTGVCLFSNSPDPIVPILGTSSAKVTE 511 V PI IF TKRYWILFRIGPERRRKA MPT +CLFSNSPDPIVP+ GTSSAKVTE Sbjct: 46 VRPILIFRTKRYWILFRIGPERRRKAEMPTDLCLFSNSPDPIVPVFGTSSAKVTE 100 >gb|KQJ86849.1| hypothetical protein BRADI_4g08051v3, partial [Brachypodium distachyon] Length = 96 Score = 97.1 bits (240), Expect = 1e-21 Identities = 47/61 (77%), Positives = 52/61 (85%) Frame = -1 Query: 675 VHPIQIFTTKRYWILFRIGPERRRKAGMPTGVCLFSNSPDPIVPILGTSSAKVTE*VSRQ 496 V PI IF TKRYWILFRIGPERRRKA MPT + LFSNSP+PIVP+ GTSSA+VTE +S Q Sbjct: 14 VRPILIFRTKRYWILFRIGPERRRKAEMPTDLSLFSNSPEPIVPVFGTSSAEVTESLSHQ 73 Query: 495 S 493 S Sbjct: 74 S 74 >gb|ACI43242.1| unknown (chloroplast) [Coix lacryma-jobi] gb|ACI43256.1| unknown (chloroplast) [Coix lacryma-jobi] Length = 99 Score = 96.7 bits (239), Expect = 2e-21 Identities = 48/61 (78%), Positives = 51/61 (83%) Frame = -1 Query: 675 VHPIQIFTTKRYWILFRIGPERRRKAGMPTGVCLFSNSPDPIVPILGTSSAKVTE*VSRQ 496 V PI IF TKR WILFRIGPERRR+A MPT +CLFSNSPD IVP+ GTSSAKVTE VS Q Sbjct: 17 VRPILIFRTKRSWILFRIGPERRREAEMPTDLCLFSNSPDRIVPVFGTSSAKVTEWVSHQ 76 Query: 495 S 493 S Sbjct: 77 S 77 >gb|PNT67434.1| hypothetical protein BRADI_3g27344v3, partial [Brachypodium distachyon] gb|PNT75429.1| hypothetical protein BRADI_1g32457v3, partial [Brachypodium distachyon] gb|PNT75857.1| hypothetical protein BRADI_1g05793v3, partial [Brachypodium distachyon] Length = 75 Score = 95.1 bits (235), Expect = 4e-21 Identities = 45/53 (84%), Positives = 48/53 (90%) Frame = -1 Query: 651 TKRYWILFRIGPERRRKAGMPTGVCLFSNSPDPIVPILGTSSAKVTE*VSRQS 493 TKRYWILFRIGPERRRKA MPT +CLFSNSP+PIVP+ GTSSAKVTE VS QS Sbjct: 1 TKRYWILFRIGPERRRKAEMPTDLCLFSNSPEPIVPVFGTSSAKVTEWVSHQS 53 >gb|PHT97076.1| hypothetical protein BC332_33997 [Capsicum chinense] Length = 471 Score = 56.2 bits (134), Expect(3) = 6e-21 Identities = 27/39 (69%), Positives = 33/39 (84%) Frame = +2 Query: 371 PPPEYMIQQESHRGRLIETSSKIPTSTRNPADKVHYIVR 487 P PEYM+QQESH+G ++ETS K+P RNPADKVHYIV+ Sbjct: 36 PSPEYMLQQESHKG-ILETSGKMP--ARNPADKVHYIVQ 71 Score = 49.7 bits (117), Expect(3) = 6e-21 Identities = 25/32 (78%), Positives = 26/32 (81%) Frame = +3 Query: 282 WNRFGSRSRNLGDLLYLMNEESVWKSSAPRHP 377 WN+FGS SRNLGDLLYLMN ES KSSA HP Sbjct: 6 WNKFGSGSRNLGDLLYLMNGESALKSSA-LHP 36 Score = 44.3 bits (103), Expect(3) = 6e-21 Identities = 20/22 (90%), Positives = 20/22 (90%) Frame = +1 Query: 493 GLATYSFSDFGTGRSQNGYYRV 558 GLATY FSDFGTGRSQNG YRV Sbjct: 72 GLATYPFSDFGTGRSQNGDYRV 93 >ref|YP_009269692.1| hypothetical chloroplast RF15 (chloroplast) [Epipactis mairei] ref|YP_009269707.1| hypothetical chloroplast RF15 (chloroplast) [Epipactis mairei] gb|ANT72602.1| hypothetical chloroplast RF15 (chloroplast) [Epipactis mairei] gb|ANT72617.1| hypothetical chloroplast RF15 (chloroplast) [Epipactis mairei] Length = 61 Score = 92.8 bits (229), Expect = 2e-20 Identities = 47/50 (94%), Positives = 47/50 (94%) Frame = -1 Query: 627 RIGPERRRKAGMPTGVCLFSNSPDPIVPILGTSSAKVTE*VSRQSLKRTM 478 RIGPERRRKAGMPT VCLFSNSPDPIVPIL TSSAKVTE VSRQSLKRTM Sbjct: 12 RIGPERRRKAGMPTDVCLFSNSPDPIVPILRTSSAKVTEWVSRQSLKRTM 61