BLASTX nr result
ID: Ophiopogon23_contig00033976
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00033976 (795 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020262482.1| uncharacterized protein LOC109838446 [Aspara... 58 6e-06 >ref|XP_020262482.1| uncharacterized protein LOC109838446 [Asparagus officinalis] Length = 363 Score = 57.8 bits (138), Expect = 6e-06 Identities = 32/85 (37%), Positives = 46/85 (54%), Gaps = 2/85 (2%) Frame = -3 Query: 784 HLFLNCPYVTSTWRSVGHNLHVTD--LPSNLFDLLATWRQVNIGRGIRMECDFYSSAIIW 611 HLF+NC +V S WRSV L++ S+L D+ W G +E D ++IW Sbjct: 234 HLFVNCEFVYSIWRSVQFKLNIKKDFKLSSLKDIWKNWSDEKYDSG-NIERDVILCSLIW 292 Query: 610 SIWNEKNRRIFQHEYRNSVPSLSSI 536 IW E+N RIF ++ R S+ L+ I Sbjct: 293 CIWQERNDRIFSNKKRRSLELLNKI 317