BLASTX nr result
ID: Ophiopogon23_contig00033690
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00033690 (570 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_022296560.1| uncharacterized protein LOC111106248 [Crasso... 56 8e-06 >ref|XP_022296560.1| uncharacterized protein LOC111106248 [Crassostrea virginica] Length = 820 Score = 56.2 bits (134), Expect = 8e-06 Identities = 23/63 (36%), Positives = 44/63 (69%) Frame = -1 Query: 354 NPTQYAAYLLSEQQRYQRRKREGKIKCIADLSEKERQAVRKKNAEYQRSLRTKQQDQVQF 175 +P ++ YL +E++RY+ RK GK+KCI++L+E+++++VRK+ + Q+ R K +D Sbjct: 19 DPEKHQRYLENEKERYRSRKNSGKLKCISELTERQKRSVRKRWRKNQKQKREKDKDIANL 78 Query: 174 VNV 166 + V Sbjct: 79 ITV 81