BLASTX nr result
ID: Ophiopogon23_contig00033644
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00033644 (379 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_014204075.1| nucleolin 1 isoform X1 [Copidosoma floridanum] 54 9e-06 >ref|XP_014204075.1| nucleolin 1 isoform X1 [Copidosoma floridanum] Length = 685 Score = 53.9 bits (128), Expect = 9e-06 Identities = 30/59 (50%), Positives = 38/59 (64%), Gaps = 3/59 (5%) Frame = +1 Query: 136 KVNNANKS-LKRKHEDDESE-NQPQKIAKKNNYSNFVKAGQD-GNAEKESEHDESFKKH 303 KV + K+ KRKH D+E E QP A KNNYSNFVK GQ+ G E++ E + FK+H Sbjct: 482 KVTSPKKNEKKRKHRDEEEEAEQPAAKAHKNNYSNFVKGGQENGEKEEDGEQNGDFKRH 540