BLASTX nr result
ID: Ophiopogon23_contig00033337
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00033337 (442 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK59023.1| uncharacterized protein A4U43_C08F2180 [Asparagus... 51 1e-08 ref|XP_020240881.1| putative pentatricopeptide repeat-containing... 51 1e-08 >gb|ONK59023.1| uncharacterized protein A4U43_C08F2180 [Asparagus officinalis] Length = 662 Score = 51.2 bits (121), Expect(2) = 1e-08 Identities = 28/80 (35%), Positives = 42/80 (52%), Gaps = 21/80 (26%) Frame = +2 Query: 5 YFTMLAANPKPSIHPFDLLTTQTLRMKNPSHDPT---------------------ILSLC 121 + ML A+PKP I+ F+LL RMK H P ++ +C Sbjct: 44 FHQMLEADPKPPIYSFNLLFISIKRMKRHLHVPISLFDTMRRVASISPDTFTYGILIDVC 103 Query: 122 NNVNQVDLSFSIFGTMLRRG 181 + +N+VDLSFS+FG++L+RG Sbjct: 104 SRMNRVDLSFSVFGSILKRG 123 Score = 35.4 bits (80), Expect(2) = 1e-08 Identities = 18/33 (54%), Positives = 22/33 (66%), Gaps = 1/33 (3%) Frame = +1 Query: 196 KKLADGTNLFDEIPQWGCAP-DVTYGVHSRLIK 291 +++ D LFDE+PQWGC P VTY S LIK Sbjct: 142 RRVDDAVKLFDEMPQWGCEPGTVTY---STLIK 171 >ref|XP_020240881.1| putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial [Asparagus officinalis] Length = 564 Score = 51.2 bits (121), Expect(2) = 1e-08 Identities = 28/80 (35%), Positives = 42/80 (52%), Gaps = 21/80 (26%) Frame = +2 Query: 5 YFTMLAANPKPSIHPFDLLTTQTLRMKNPSHDPT---------------------ILSLC 121 + ML A+PKP I+ F+LL RMK H P ++ +C Sbjct: 44 FHQMLEADPKPPIYSFNLLFISIKRMKRHLHVPISLFDTMRRVASISPDTFTYGILIDVC 103 Query: 122 NNVNQVDLSFSIFGTMLRRG 181 + +N+VDLSFS+FG++L+RG Sbjct: 104 SRMNRVDLSFSVFGSILKRG 123 Score = 35.4 bits (80), Expect(2) = 1e-08 Identities = 18/33 (54%), Positives = 22/33 (66%), Gaps = 1/33 (3%) Frame = +1 Query: 196 KKLADGTNLFDEIPQWGCAP-DVTYGVHSRLIK 291 +++ D LFDE+PQWGC P VTY S LIK Sbjct: 142 RRVDDAVKLFDEMPQWGCEPGTVTY---STLIK 171