BLASTX nr result
ID: Ophiopogon23_contig00033270
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00033270 (490 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK58087.1| uncharacterized protein A4U43_C09F7980 [Asparagus... 66 8e-10 ref|XP_020245161.1| LOW QUALITY PROTEIN: GPI transamidase compon... 66 1e-09 gb|EMS46881.1| GPI transamidase component PIG-T [Triticum urartu] 66 2e-09 dbj|BAJ95630.1| predicted protein [Hordeum vulgare subsp. vulgare] 66 2e-09 ref|XP_003577571.1| PREDICTED: GPI transamidase component PIG-T ... 65 5e-09 ref|XP_020169167.1| GPI transamidase component PIG-T-like [Aegil... 64 8e-09 dbj|BAH95266.1| Os11g0479232 [Oryza sativa Japonica Group] 63 1e-08 ref|XP_008775255.1| PREDICTED: GPI transamidase component PIG-T ... 62 3e-08 ref|XP_004965951.1| GPI transamidase component PIG-T [Setaria it... 62 3e-08 gb|OEL35719.1| GPI transamidase component PIG-T, partial [Dichan... 62 4e-08 gb|OEL32820.1| GPI transamidase component PIG-T [Dichanthelium o... 62 4e-08 gb|PKA61257.1| hypothetical protein AXF42_Ash006154 [Apostasia s... 62 6e-08 ref|XP_009403615.1| PREDICTED: GPI transamidase component PIG-T ... 61 7e-08 ref|XP_009403614.1| PREDICTED: GPI transamidase component PIG-T ... 61 7e-08 ref|XP_010929800.1| PREDICTED: GPI transamidase component PIG-T ... 61 1e-07 gb|OVA19112.1| GPI transamidase component PIG-T [Macleaya cordata] 61 1e-07 gb|PAN23432.1| hypothetical protein PAHAL_D00950 [Panicum hallii] 61 1e-07 ref|XP_019708558.1| PREDICTED: GPI transamidase component PIG-T ... 61 1e-07 ref|XP_010929799.1| PREDICTED: GPI transamidase component PIG-T ... 61 1e-07 gb|PAN23433.1| hypothetical protein PAHAL_D00950 [Panicum hallii] 61 1e-07 >gb|ONK58087.1| uncharacterized protein A4U43_C09F7980 [Asparagus officinalis] Length = 302 Score = 66.2 bits (160), Expect = 8e-10 Identities = 30/35 (85%), Positives = 34/35 (97%) Frame = -1 Query: 490 QVSPSEDKVSPGTLEMMLRFPCSMQSASLVLDFDK 386 ++SPSEDKVSPG LE+MLRFPC+MQSASLVLDFDK Sbjct: 96 RISPSEDKVSPGMLELMLRFPCNMQSASLVLDFDK 130 >ref|XP_020245161.1| LOW QUALITY PROTEIN: GPI transamidase component PIG-T [Asparagus officinalis] Length = 666 Score = 66.2 bits (160), Expect = 1e-09 Identities = 30/35 (85%), Positives = 34/35 (97%) Frame = -1 Query: 490 QVSPSEDKVSPGTLEMMLRFPCSMQSASLVLDFDK 386 ++SPSEDKVSPG LE+MLRFPC+MQSASLVLDFDK Sbjct: 460 RISPSEDKVSPGMLELMLRFPCNMQSASLVLDFDK 494 >gb|EMS46881.1| GPI transamidase component PIG-T [Triticum urartu] Length = 596 Score = 65.9 bits (159), Expect = 2e-09 Identities = 29/34 (85%), Positives = 34/34 (100%) Frame = -1 Query: 487 VSPSEDKVSPGTLEMMLRFPCSMQSASLVLDFDK 386 V+PSEDK+SPGTLEM+LRFPCSMQSA+L+LDFDK Sbjct: 397 VTPSEDKLSPGTLEMLLRFPCSMQSATLILDFDK 430 >dbj|BAJ95630.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 638 Score = 65.9 bits (159), Expect = 2e-09 Identities = 29/34 (85%), Positives = 34/34 (100%) Frame = -1 Query: 487 VSPSEDKVSPGTLEMMLRFPCSMQSASLVLDFDK 386 V+PSEDK+SPGTLEM+LRFPCSMQSA+L+LDFDK Sbjct: 439 VTPSEDKLSPGTLEMLLRFPCSMQSATLILDFDK 472 >ref|XP_003577571.1| PREDICTED: GPI transamidase component PIG-T [Brachypodium distachyon] gb|KQJ88525.1| hypothetical protein BRADI_4g19100v3 [Brachypodium distachyon] Length = 636 Score = 64.7 bits (156), Expect = 5e-09 Identities = 29/34 (85%), Positives = 33/34 (97%) Frame = -1 Query: 487 VSPSEDKVSPGTLEMMLRFPCSMQSASLVLDFDK 386 V+PSEDK+SPGTLEM+LRFPCSMQSA+L LDFDK Sbjct: 437 VTPSEDKLSPGTLEMLLRFPCSMQSATLTLDFDK 470 >ref|XP_020169167.1| GPI transamidase component PIG-T-like [Aegilops tauschii subsp. tauschii] Length = 310 Score = 63.5 bits (153), Expect = 8e-09 Identities = 28/34 (82%), Positives = 33/34 (97%) Frame = -1 Query: 487 VSPSEDKVSPGTLEMMLRFPCSMQSASLVLDFDK 386 V+PSEDK+SPGTLEM+LRFPC MQSA+L+LDFDK Sbjct: 111 VTPSEDKLSPGTLEMLLRFPCGMQSATLMLDFDK 144 >dbj|BAH95266.1| Os11g0479232 [Oryza sativa Japonica Group] Length = 432 Score = 63.2 bits (152), Expect = 1e-08 Identities = 29/37 (78%), Positives = 33/37 (89%) Frame = -1 Query: 487 VSPSEDKVSPGTLEMMLRFPCSMQSASLVLDFDKVCS 377 V+PSEDK PGTLEM+LR PCSM+SA+L LDFDKVCS Sbjct: 394 VTPSEDKHLPGTLEMLLRLPCSMESATLSLDFDKVCS 430 >ref|XP_008775255.1| PREDICTED: GPI transamidase component PIG-T homolog [Phoenix dactylifera] Length = 566 Score = 62.4 bits (150), Expect = 3e-08 Identities = 28/35 (80%), Positives = 32/35 (91%) Frame = -1 Query: 490 QVSPSEDKVSPGTLEMMLRFPCSMQSASLVLDFDK 386 QV+PSEDK+ PGTLE+MLRFPCSM SA+L LDFDK Sbjct: 357 QVTPSEDKLLPGTLELMLRFPCSMHSATLTLDFDK 391 >ref|XP_004965951.1| GPI transamidase component PIG-T [Setaria italica] gb|KQL11516.1| hypothetical protein SETIT_006035mg [Setaria italica] Length = 645 Score = 62.4 bits (150), Expect = 3e-08 Identities = 28/34 (82%), Positives = 32/34 (94%) Frame = -1 Query: 487 VSPSEDKVSPGTLEMMLRFPCSMQSASLVLDFDK 386 V+PSEDK+ PGTLEM+LRFPCSMQSA+L LDFDK Sbjct: 445 VTPSEDKLLPGTLEMLLRFPCSMQSATLTLDFDK 478 >gb|OEL35719.1| GPI transamidase component PIG-T, partial [Dichanthelium oligosanthes] Length = 470 Score = 62.0 bits (149), Expect = 4e-08 Identities = 28/34 (82%), Positives = 32/34 (94%) Frame = -1 Query: 487 VSPSEDKVSPGTLEMMLRFPCSMQSASLVLDFDK 386 V+PSEDK+ PGTLEM+LRFPCSMQSA+L LDFDK Sbjct: 337 VTPSEDKLLPGTLEMVLRFPCSMQSATLTLDFDK 370 >gb|OEL32820.1| GPI transamidase component PIG-T [Dichanthelium oligosanthes] Length = 669 Score = 62.0 bits (149), Expect = 4e-08 Identities = 28/34 (82%), Positives = 32/34 (94%) Frame = -1 Query: 487 VSPSEDKVSPGTLEMMLRFPCSMQSASLVLDFDK 386 V+PSEDK+ PGTLEM+LRFPCSMQSA+L LDFDK Sbjct: 445 VTPSEDKLLPGTLEMVLRFPCSMQSATLTLDFDK 478 >gb|PKA61257.1| hypothetical protein AXF42_Ash006154 [Apostasia shenzhenica] Length = 666 Score = 61.6 bits (148), Expect = 6e-08 Identities = 26/35 (74%), Positives = 32/35 (91%) Frame = -1 Query: 490 QVSPSEDKVSPGTLEMMLRFPCSMQSASLVLDFDK 386 ++SPSEDK+SPGT+E+ML FPC MQSA+L LDFDK Sbjct: 456 KISPSEDKLSPGTMELMLEFPCDMQSATLTLDFDK 490 >ref|XP_009403615.1| PREDICTED: GPI transamidase component PIG-T isoform X2 [Musa acuminata subsp. malaccensis] Length = 650 Score = 61.2 bits (147), Expect = 7e-08 Identities = 27/35 (77%), Positives = 32/35 (91%) Frame = -1 Query: 490 QVSPSEDKVSPGTLEMMLRFPCSMQSASLVLDFDK 386 QVSPSEDK+ PGTLE+MLR+PCS+QS +L LDFDK Sbjct: 452 QVSPSEDKLFPGTLELMLRYPCSVQSVALTLDFDK 486 >ref|XP_009403614.1| PREDICTED: GPI transamidase component PIG-T isoform X1 [Musa acuminata subsp. malaccensis] Length = 651 Score = 61.2 bits (147), Expect = 7e-08 Identities = 27/35 (77%), Positives = 32/35 (91%) Frame = -1 Query: 490 QVSPSEDKVSPGTLEMMLRFPCSMQSASLVLDFDK 386 QVSPSEDK+ PGTLE+MLR+PCS+QS +L LDFDK Sbjct: 452 QVSPSEDKLFPGTLELMLRYPCSVQSVALTLDFDK 486 >ref|XP_010929800.1| PREDICTED: GPI transamidase component PIG-T isoform X3 [Elaeis guineensis] Length = 568 Score = 60.8 bits (146), Expect = 1e-07 Identities = 27/35 (77%), Positives = 31/35 (88%) Frame = -1 Query: 490 QVSPSEDKVSPGTLEMMLRFPCSMQSASLVLDFDK 386 QV+PSEDK+ PGTLE+MLRFPCSM S +L LDFDK Sbjct: 479 QVTPSEDKLLPGTLELMLRFPCSMHSGTLTLDFDK 513 >gb|OVA19112.1| GPI transamidase component PIG-T [Macleaya cordata] Length = 634 Score = 60.8 bits (146), Expect = 1e-07 Identities = 25/34 (73%), Positives = 33/34 (97%) Frame = -1 Query: 487 VSPSEDKVSPGTLEMMLRFPCSMQSASLVLDFDK 386 VSPSED+VSPG +EM+LRFPCSM+SA++++DFDK Sbjct: 458 VSPSEDRVSPGVMEMVLRFPCSMKSATIIIDFDK 491 >gb|PAN23432.1| hypothetical protein PAHAL_D00950 [Panicum hallii] Length = 645 Score = 60.8 bits (146), Expect = 1e-07 Identities = 27/34 (79%), Positives = 32/34 (94%) Frame = -1 Query: 487 VSPSEDKVSPGTLEMMLRFPCSMQSASLVLDFDK 386 V+PSEDK+ PGTLEM+LRFPCSM+SA+L LDFDK Sbjct: 446 VTPSEDKLLPGTLEMLLRFPCSMRSATLALDFDK 479 >ref|XP_019708558.1| PREDICTED: GPI transamidase component PIG-T isoform X2 [Elaeis guineensis] Length = 649 Score = 60.8 bits (146), Expect = 1e-07 Identities = 27/35 (77%), Positives = 31/35 (88%) Frame = -1 Query: 490 QVSPSEDKVSPGTLEMMLRFPCSMQSASLVLDFDK 386 QV+PSEDK+ PGTLE+MLRFPCSM S +L LDFDK Sbjct: 440 QVTPSEDKLLPGTLELMLRFPCSMHSGTLTLDFDK 474 >ref|XP_010929799.1| PREDICTED: GPI transamidase component PIG-T isoform X1 [Elaeis guineensis] Length = 688 Score = 60.8 bits (146), Expect = 1e-07 Identities = 27/35 (77%), Positives = 31/35 (88%) Frame = -1 Query: 490 QVSPSEDKVSPGTLEMMLRFPCSMQSASLVLDFDK 386 QV+PSEDK+ PGTLE+MLRFPCSM S +L LDFDK Sbjct: 479 QVTPSEDKLLPGTLELMLRFPCSMHSGTLTLDFDK 513 >gb|PAN23433.1| hypothetical protein PAHAL_D00950 [Panicum hallii] Length = 710 Score = 60.8 bits (146), Expect = 1e-07 Identities = 27/34 (79%), Positives = 32/34 (94%) Frame = -1 Query: 487 VSPSEDKVSPGTLEMMLRFPCSMQSASLVLDFDK 386 V+PSEDK+ PGTLEM+LRFPCSM+SA+L LDFDK Sbjct: 511 VTPSEDKLLPGTLEMLLRFPCSMRSATLALDFDK 544