BLASTX nr result
ID: Ophiopogon23_contig00032359
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00032359 (409 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020250716.1| nitrilase-like protein 2 [Asparagus officina... 60 7e-08 ref|XP_008792618.1| PREDICTED: nitrilase-like protein 2 [Phoenix... 55 3e-06 >ref|XP_020250716.1| nitrilase-like protein 2 [Asparagus officinalis] gb|ONK54892.1| uncharacterized protein A4U43_UnF10000 [Asparagus officinalis] Length = 332 Score = 60.1 bits (144), Expect = 7e-08 Identities = 28/33 (84%), Positives = 32/33 (96%) Frame = +2 Query: 2 GIAIAEIDLSRIDAVRTRMPISEHKKLDSCQKI 100 GIAIA+IDLS +DAVRTRMPISEHK+L+SCQKI Sbjct: 294 GIAIADIDLSIVDAVRTRMPISEHKRLESCQKI 326 >ref|XP_008792618.1| PREDICTED: nitrilase-like protein 2 [Phoenix dactylifera] Length = 312 Score = 55.5 bits (132), Expect = 3e-06 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = +2 Query: 2 GIAIAEIDLSRIDAVRTRMPISEHKKLDSCQK 97 GIA+A+IDLSRID+VRTRMPISEH+K SC K Sbjct: 277 GIAVADIDLSRIDSVRTRMPISEHRKFSSCWK 308