BLASTX nr result
ID: Ophiopogon23_contig00030586
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00030586 (505 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020272996.1| extra-large guanine nucleotide-binding prote... 91 6e-18 ref|XP_020258790.1| LOW QUALITY PROTEIN: extra-large guanine nuc... 83 3e-15 ref|XP_020584148.1| extra-large guanine nucleotide-binding prote... 72 2e-11 ref|XP_009399100.1| PREDICTED: extra-large guanine nucleotide-bi... 71 4e-11 gb|PKA56804.1| Guanine nucleotide-binding protein alpha-2 subuni... 71 4e-11 ref|XP_010908031.1| PREDICTED: extra-large guanine nucleotide-bi... 70 8e-11 ref|XP_010908029.1| PREDICTED: extra-large guanine nucleotide-bi... 70 8e-11 ref|XP_010908028.1| PREDICTED: extra-large guanine nucleotide-bi... 70 8e-11 ref|XP_010941889.1| PREDICTED: extra-large guanine nucleotide-bi... 70 1e-10 ref|XP_010941888.1| PREDICTED: extra-large guanine nucleotide-bi... 70 1e-10 ref|XP_020700519.1| extra-large guanine nucleotide-binding prote... 69 1e-10 ref|XP_008813184.1| PREDICTED: extra-large guanine nucleotide-bi... 69 1e-10 ref|XP_008813183.1| PREDICTED: extra-large guanine nucleotide-bi... 69 1e-10 gb|OMO75266.1| Guanine nucleotide binding protein (G-protein), a... 68 4e-10 gb|OMO92174.1| Guanine nucleotide binding protein (G-protein), a... 68 5e-10 ref|XP_017970536.1| PREDICTED: extra-large guanine nucleotide-bi... 66 2e-09 ref|XP_017970535.1| PREDICTED: extra-large guanine nucleotide-bi... 66 2e-09 ref|XP_017970534.1| PREDICTED: extra-large guanine nucleotide-bi... 66 2e-09 gb|OAY67999.1| Extra-large guanine nucleotide-binding protein 1 ... 66 2e-09 gb|OAY78841.1| Extra-large guanine nucleotide-binding protein 1 ... 66 2e-09 >ref|XP_020272996.1| extra-large guanine nucleotide-binding protein 1-like [Asparagus officinalis] gb|ONK64869.1| uncharacterized protein A4U43_C07F30830 [Asparagus officinalis] Length = 797 Score = 90.5 bits (223), Expect = 6e-18 Identities = 49/82 (59%), Positives = 58/82 (70%) Frame = +2 Query: 197 EYSLAIEYSGPPLPFVIPKAIPIEIEQIPVASIATSAPPLDSLPIVQPLPFKKPWNQAQE 376 EYS AIEYSGP F IPKA PIEI++IPVAS+ATSAP LDSLP+VQPLP KK Sbjct: 12 EYSFAIEYSGPLFSFDIPKASPIEIDKIPVASVATSAPALDSLPVVQPLPLKK----RLP 67 Query: 377 KDEEEEGRDLISSSELKGTDDT 442 E+++ + SSELK TD + Sbjct: 68 DQEQDQNLNFNFSSELKVTDSS 89 >ref|XP_020258790.1| LOW QUALITY PROTEIN: extra-large guanine nucleotide-binding protein 1-like [Asparagus officinalis] Length = 906 Score = 82.8 bits (203), Expect = 3e-15 Identities = 46/81 (56%), Positives = 52/81 (64%) Frame = +2 Query: 200 YSLAIEYSGPPLPFVIPKAIPIEIEQIPVASIATSAPPLDSLPIVQPLPFKKPWNQAQEK 379 Y A EY GP +PF IPKAIPIEIEQIPVASIATSAPPL SLP+V+PL Sbjct: 131 YPRAAEYDGPXVPFEIPKAIPIEIEQIPVASIATSAPPLHSLPVVKPL------------ 178 Query: 380 DEEEEGRDLISSSELKGTDDT 442 + D+ISSSEL D+ Sbjct: 179 ----QDLDIISSSELNAATDS 195 >ref|XP_020584148.1| extra-large guanine nucleotide-binding protein 1 [Phalaenopsis equestris] ref|XP_020584149.1| extra-large guanine nucleotide-binding protein 1 [Phalaenopsis equestris] ref|XP_020584150.1| extra-large guanine nucleotide-binding protein 1 [Phalaenopsis equestris] ref|XP_020584152.1| extra-large guanine nucleotide-binding protein 1 [Phalaenopsis equestris] Length = 861 Score = 72.0 bits (175), Expect = 2e-11 Identities = 33/60 (55%), Positives = 47/60 (78%), Gaps = 2/60 (3%) Frame = +2 Query: 194 VEYSLAIEYSGPPLPFVIPKAIPIEIEQIPVASIATSAPPLD--SLPIVQPLPFKKPWNQ 367 V+Y+LA+EYSGPP+P+ IP+AIPIEIE+IP+A++ + A D SLP+ QPLP P+ + Sbjct: 18 VDYALAVEYSGPPIPYEIPQAIPIEIERIPIAAVVSPALLSDHLSLPVAQPLPSPNPFKK 77 >ref|XP_009399100.1| PREDICTED: extra-large guanine nucleotide-binding protein 1-like [Musa acuminata subsp. malaccensis] Length = 880 Score = 70.9 bits (172), Expect = 4e-11 Identities = 30/56 (53%), Positives = 44/56 (78%), Gaps = 2/56 (3%) Frame = +2 Query: 197 EYSLAIEYSGPPLPFVIPKAIPIEIEQIPVASIATSAPPLDSLPIVQPL--PFKKP 358 +YS A+EY+GPPLP+ IP+A+PI++ +IP+A++A + L LP+V PL PFKKP Sbjct: 13 DYSFAVEYNGPPLPYEIPRAVPIDVNRIPLAAVAPPSAVLSDLPVVHPLPSPFKKP 68 >gb|PKA56804.1| Guanine nucleotide-binding protein alpha-2 subunit [Apostasia shenzhenica] Length = 886 Score = 70.9 bits (172), Expect = 4e-11 Identities = 44/113 (38%), Positives = 61/113 (53%), Gaps = 26/113 (23%) Frame = +2 Query: 194 VEYSLAIEYSGPPLPFVIPKAIPIEIEQIPVASIATSAPPLDS--LPIVQPL----PFKK 355 V+Y+ A+EY+GPP+P+ IP+AIPIEIE+IPVA++A +A D LP+VQPL P KK Sbjct: 7 VDYAFAVEYTGPPIPYEIPQAIPIEIERIPVATVAAAASLPDHLLLPVVQPLPSPDPLKK 66 Query: 356 PWNQAQE--------------------KDEEEEGRDLISSSELKGTDDTGGNR 454 P E E E ++ SELKG+ D+ + Sbjct: 67 PPPPPSEHAVSSPTSVIENHIAPDGELSGEVESSGAVVFCSELKGSPDSADGK 119 >ref|XP_010908031.1| PREDICTED: extra-large guanine nucleotide-binding protein 1-like isoform X3 [Elaeis guineensis] Length = 941 Score = 70.1 bits (170), Expect = 8e-11 Identities = 36/57 (63%), Positives = 43/57 (75%), Gaps = 2/57 (3%) Frame = +2 Query: 194 VEYSLAIEYSGPPLPFVIPKAIPIEIEQIPVASIA--TSAPPLDSLPIVQPLPFKKP 358 V+YS AIEY GPP+P+ IP+AIPIEIE+IPVA++A T P SLPIV PLP P Sbjct: 21 VDYSFAIEYHGPPVPYEIPEAIPIEIERIPVAAVAAQTKLPDPLSLPIVPPLPSPGP 77 >ref|XP_010908029.1| PREDICTED: extra-large guanine nucleotide-binding protein 1-like isoform X2 [Elaeis guineensis] Length = 942 Score = 70.1 bits (170), Expect = 8e-11 Identities = 36/57 (63%), Positives = 43/57 (75%), Gaps = 2/57 (3%) Frame = +2 Query: 194 VEYSLAIEYSGPPLPFVIPKAIPIEIEQIPVASIA--TSAPPLDSLPIVQPLPFKKP 358 V+YS AIEY GPP+P+ IP+AIPIEIE+IPVA++A T P SLPIV PLP P Sbjct: 21 VDYSFAIEYHGPPVPYEIPEAIPIEIERIPVAAVAAQTKLPDPLSLPIVPPLPSPGP 77 >ref|XP_010908028.1| PREDICTED: extra-large guanine nucleotide-binding protein 1-like isoform X1 [Elaeis guineensis] Length = 943 Score = 70.1 bits (170), Expect = 8e-11 Identities = 36/57 (63%), Positives = 43/57 (75%), Gaps = 2/57 (3%) Frame = +2 Query: 194 VEYSLAIEYSGPPLPFVIPKAIPIEIEQIPVASIA--TSAPPLDSLPIVQPLPFKKP 358 V+YS AIEY GPP+P+ IP+AIPIEIE+IPVA++A T P SLPIV PLP P Sbjct: 21 VDYSFAIEYHGPPVPYEIPEAIPIEIERIPVAAVAAQTKLPDPLSLPIVPPLPSPGP 77 >ref|XP_010941889.1| PREDICTED: extra-large guanine nucleotide-binding protein 1 isoform X2 [Elaeis guineensis] Length = 970 Score = 69.7 bits (169), Expect = 1e-10 Identities = 34/56 (60%), Positives = 44/56 (78%), Gaps = 2/56 (3%) Frame = +2 Query: 197 EYSLAIEYSGPPLPFVIPKAIPIEIEQIPVASIA--TSAPPLDSLPIVQPLPFKKP 358 +YS AIEY GPP+P+ IP+AIPIEIE+IPVA++A ++ P SLP+VQPLP P Sbjct: 35 DYSFAIEYHGPPVPYEIPEAIPIEIERIPVAAVAAPSALPDPISLPVVQPLPSPGP 90 >ref|XP_010941888.1| PREDICTED: extra-large guanine nucleotide-binding protein 1 isoform X1 [Elaeis guineensis] Length = 971 Score = 69.7 bits (169), Expect = 1e-10 Identities = 34/56 (60%), Positives = 44/56 (78%), Gaps = 2/56 (3%) Frame = +2 Query: 197 EYSLAIEYSGPPLPFVIPKAIPIEIEQIPVASIA--TSAPPLDSLPIVQPLPFKKP 358 +YS AIEY GPP+P+ IP+AIPIEIE+IPVA++A ++ P SLP+VQPLP P Sbjct: 35 DYSFAIEYHGPPVPYEIPEAIPIEIERIPVAAVAAPSALPDPISLPVVQPLPSPGP 90 >ref|XP_020700519.1| extra-large guanine nucleotide-binding protein 1 [Dendrobium catenatum] gb|PKU81129.1| Guanine nucleotide-binding protein alpha-2 subunit [Dendrobium catenatum] Length = 862 Score = 69.3 bits (168), Expect = 1e-10 Identities = 39/100 (39%), Positives = 58/100 (58%), Gaps = 19/100 (19%) Frame = +2 Query: 194 VEYSLAIEYSGPPLPFVIPKAIPIEIEQIPVASIATSAPPLD--SLPIVQPLPFKKPWNQ 367 ++Y+ A+EYSGPP+P+ IP+AIPIEIE+IPVA++ + A D +LP+ QPLP P + Sbjct: 18 IDYAFAVEYSGPPVPYEIPQAIPIEIERIPVATVVSPAFLSDQLALPVAQPLPSPNPLKK 77 Query: 368 A-----------------QEKDEEEEGRDLISSSELKGTD 436 A + E ++ SSELKG++ Sbjct: 78 ADVYSPTSVIENHIAVDGELSGEVASSGAVVFSSELKGSE 117 >ref|XP_008813184.1| PREDICTED: extra-large guanine nucleotide-binding protein 1-like isoform X2 [Phoenix dactylifera] Length = 958 Score = 69.3 bits (168), Expect = 1e-10 Identities = 34/56 (60%), Positives = 44/56 (78%), Gaps = 2/56 (3%) Frame = +2 Query: 197 EYSLAIEYSGPPLPFVIPKAIPIEIEQIPVASIA--TSAPPLDSLPIVQPLPFKKP 358 +YS AIEY GPP+P+ IP+AIPIEIE+IPVA++A ++ P SLP+VQPLP P Sbjct: 22 DYSFAIEYHGPPVPYEIPEAIPIEIERIPVAAVAAPSALPDPLSLPVVQPLPSPGP 77 >ref|XP_008813183.1| PREDICTED: extra-large guanine nucleotide-binding protein 1-like isoform X1 [Phoenix dactylifera] Length = 959 Score = 69.3 bits (168), Expect = 1e-10 Identities = 34/56 (60%), Positives = 44/56 (78%), Gaps = 2/56 (3%) Frame = +2 Query: 197 EYSLAIEYSGPPLPFVIPKAIPIEIEQIPVASIA--TSAPPLDSLPIVQPLPFKKP 358 +YS AIEY GPP+P+ IP+AIPIEIE+IPVA++A ++ P SLP+VQPLP P Sbjct: 22 DYSFAIEYHGPPVPYEIPEAIPIEIERIPVAAVAAPSALPDPLSLPVVQPLPSPGP 77 >gb|OMO75266.1| Guanine nucleotide binding protein (G-protein), alpha subunit [Corchorus capsularis] Length = 921 Score = 68.2 bits (165), Expect = 4e-10 Identities = 31/66 (46%), Positives = 48/66 (72%), Gaps = 2/66 (3%) Frame = +2 Query: 194 VEYSLAIEYSGPPLPFVIPKAIPIEIEQIPVASIATSAPPLD--SLPIVQPLPFKKPWNQ 367 VEYS+AIEY GPP+ + IPKA+P+++E++P A+ +S+ L+ SLP++QP+ P NQ Sbjct: 26 VEYSIAIEYHGPPINYDIPKAVPVDVEELPTAATVSSSYVLNDISLPVIQPIVKTNPVNQ 85 Query: 368 AQEKDE 385 KD+ Sbjct: 86 KLSKDK 91 >gb|OMO92174.1| Guanine nucleotide binding protein (G-protein), alpha subunit [Corchorus olitorius] Length = 908 Score = 67.8 bits (164), Expect = 5e-10 Identities = 30/67 (44%), Positives = 49/67 (73%), Gaps = 2/67 (2%) Frame = +2 Query: 194 VEYSLAIEYSGPPLPFVIPKAIPIEIEQIPVASIATSAPPLD--SLPIVQPLPFKKPWNQ 367 VEYS+AIEY GPP+ + IPKA+P++++++P A+ +S+ L+ SLP++QP+ P NQ Sbjct: 26 VEYSIAIEYHGPPISYDIPKAVPVDVDELPTAATVSSSYVLNDISLPVIQPIVKTNPVNQ 85 Query: 368 AQEKDEE 388 KD++ Sbjct: 86 KLSKDKK 92 >ref|XP_017970536.1| PREDICTED: extra-large guanine nucleotide-binding protein 1 isoform X3 [Theobroma cacao] Length = 744 Score = 66.2 bits (160), Expect = 2e-09 Identities = 29/64 (45%), Positives = 48/64 (75%), Gaps = 6/64 (9%) Frame = +2 Query: 194 VEYSLAIEYSGPPLPFVIPKAIPIEIEQIPVASIATSAPPL--DSLPIVQPL----PFKK 355 VEYS AIEY GPP+P+ IPKA+P++++Q+P A+ +S+ L +S+P++QP+ P K+ Sbjct: 26 VEYSFAIEYHGPPVPYDIPKAVPVDVDQLPTAATVSSSYVLNENSVPVIQPIVKANPVKQ 85 Query: 356 PWNQ 367 W++ Sbjct: 86 KWSE 89 >ref|XP_017970535.1| PREDICTED: extra-large guanine nucleotide-binding protein 1 isoform X2 [Theobroma cacao] gb|EOX97204.1| Extra-large G-protein 1, putative [Theobroma cacao] Length = 922 Score = 66.2 bits (160), Expect = 2e-09 Identities = 29/64 (45%), Positives = 48/64 (75%), Gaps = 6/64 (9%) Frame = +2 Query: 194 VEYSLAIEYSGPPLPFVIPKAIPIEIEQIPVASIATSAPPL--DSLPIVQPL----PFKK 355 VEYS AIEY GPP+P+ IPKA+P++++Q+P A+ +S+ L +S+P++QP+ P K+ Sbjct: 26 VEYSFAIEYHGPPVPYDIPKAVPVDVDQLPTAATVSSSYVLNENSVPVIQPIVKANPVKQ 85 Query: 356 PWNQ 367 W++ Sbjct: 86 KWSE 89 >ref|XP_017970534.1| PREDICTED: extra-large guanine nucleotide-binding protein 1 isoform X1 [Theobroma cacao] Length = 939 Score = 66.2 bits (160), Expect = 2e-09 Identities = 29/64 (45%), Positives = 48/64 (75%), Gaps = 6/64 (9%) Frame = +2 Query: 194 VEYSLAIEYSGPPLPFVIPKAIPIEIEQIPVASIATSAPPL--DSLPIVQPL----PFKK 355 VEYS AIEY GPP+P+ IPKA+P++++Q+P A+ +S+ L +S+P++QP+ P K+ Sbjct: 26 VEYSFAIEYHGPPVPYDIPKAVPVDVDQLPTAATVSSSYVLNENSVPVIQPIVKANPVKQ 85 Query: 356 PWNQ 367 W++ Sbjct: 86 KWSE 89 >gb|OAY67999.1| Extra-large guanine nucleotide-binding protein 1 [Ananas comosus] Length = 850 Score = 65.9 bits (159), Expect = 2e-09 Identities = 32/57 (56%), Positives = 45/57 (78%), Gaps = 4/57 (7%) Frame = +2 Query: 197 EYSLAIEYSGPPLPFVIPKAIPIEIEQIPVASIA--TSAPPLDSLPIVQPL--PFKK 355 +YS A+EY GPPLP+ IPKAIPIEIE+IPVA++A +++ ++LP+V PL P +K Sbjct: 6 DYSFAVEYHGPPLPYDIPKAIPIEIERIPVAAVAPPSASDAAEALPVVHPLTSPLRK 62 >gb|OAY78841.1| Extra-large guanine nucleotide-binding protein 1 [Ananas comosus] Length = 859 Score = 65.9 bits (159), Expect = 2e-09 Identities = 32/57 (56%), Positives = 45/57 (78%), Gaps = 4/57 (7%) Frame = +2 Query: 197 EYSLAIEYSGPPLPFVIPKAIPIEIEQIPVASIA--TSAPPLDSLPIVQPL--PFKK 355 +YS A+EY GPPLP+ IPKAIPIEIE+IPVA++A +++ ++LP+V PL P +K Sbjct: 6 DYSFAVEYHGPPLPYDIPKAIPIEIERIPVAAVAPPSASDAAEALPVVHPLTSPLRK 62