BLASTX nr result
ID: Ophiopogon23_contig00029956
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00029956 (541 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020249761.1| DDT domain-containing protein DDR4-like [Asp... 104 8e-23 >ref|XP_020249761.1| DDT domain-containing protein DDR4-like [Asparagus officinalis] gb|ONK80805.1| uncharacterized protein A4U43_C01F21950 [Asparagus officinalis] Length = 553 Score = 104 bits (260), Expect = 8e-23 Identities = 57/82 (69%), Positives = 64/82 (78%) Frame = -1 Query: 352 DSPKRKRNHRDTKCKAGVGVRRSQRFVEPSKGLAETKKRLRQRPTRNSAQVVSDSEDSCS 173 DSPK+ N + + KA VGVRRSQRF E S+G AETKKRLRQRPTRNSAQ+VSDSEDS S Sbjct: 450 DSPKQTINQNNARTKAAVGVRRSQRFTEISEGPAETKKRLRQRPTRNSAQMVSDSEDS-S 508 Query: 172 QENGKAIEMVSDSEMEDSAASG 107 +N K E+VSDSEM DSA G Sbjct: 509 PKNEKQTEIVSDSEMADSAGDG 530