BLASTX nr result
ID: Ophiopogon23_contig00029951
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon23_contig00029951 (452 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020273559.1| pentatricopeptide repeat-containing protein ... 75 6e-13 ref|XP_019706414.1| PREDICTED: LOW QUALITY PROTEIN: pentatricope... 60 2e-07 gb|PKU87418.1| Pentatricopeptide repeat-containing protein [Dend... 56 3e-06 ref|XP_020695065.1| pentatricopeptide repeat-containing protein ... 56 3e-06 ref|XP_020103675.1| pentatricopeptide repeat-containing protein ... 55 8e-06 >ref|XP_020273559.1| pentatricopeptide repeat-containing protein At5g57250, mitochondrial [Asparagus officinalis] ref|XP_020273560.1| pentatricopeptide repeat-containing protein At5g57250, mitochondrial [Asparagus officinalis] ref|XP_020273561.1| pentatricopeptide repeat-containing protein At5g57250, mitochondrial [Asparagus officinalis] gb|ONK62759.1| uncharacterized protein A4U43_C07F7840 [Asparagus officinalis] Length = 1072 Score = 75.5 bits (184), Expect = 6e-13 Identities = 36/63 (57%), Positives = 48/63 (76%) Frame = -3 Query: 435 NHGLFKINSEMDTNVEEYEFLSRESLPCDFDSFYTIIASLCSVGDLQKANSVVTTMLMTS 256 N+GL +I+ + DTNV YE L +SLP D+D+ ++IIASLCS G+LQKAN+ V TML+ S Sbjct: 1009 NNGLCEISDKKDTNVGNYELLFEKSLPYDYDASFSIIASLCSRGELQKANNAVKTMLLAS 1068 Query: 255 DKH 247 D H Sbjct: 1069 DGH 1071 >ref|XP_019706414.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At5g57250, mitochondrial [Elaeis guineensis] Length = 1080 Score = 59.7 bits (143), Expect = 2e-07 Identities = 29/51 (56%), Positives = 38/51 (74%) Frame = -3 Query: 408 EMDTNVEEYEFLSRESLPCDFDSFYTIIASLCSVGDLQKANSVVTTMLMTS 256 + D +E+YE L SL DFD++Y+IIASLCS G+L KANSVV ML++S Sbjct: 1026 DKDHELEDYEHLIANSLCYDFDAYYSIIASLCSKGELHKANSVVKAMLLSS 1076 >gb|PKU87418.1| Pentatricopeptide repeat-containing protein [Dendrobium catenatum] Length = 1104 Score = 56.2 bits (134), Expect = 3e-06 Identities = 28/56 (50%), Positives = 39/56 (69%) Frame = -3 Query: 432 HGLFKINSEMDTNVEEYEFLSRESLPCDFDSFYTIIASLCSVGDLQKANSVVTTML 265 HGL +N ++ + EY FL + SL DF++FY+IIA+LCS G+LQKAN +V L Sbjct: 1048 HGLC-MNKTTNSVLNEYNFLCQNSLKYDFETFYSIIATLCSKGELQKANDIVKATL 1102 >ref|XP_020695065.1| pentatricopeptide repeat-containing protein At5g57250, mitochondrial [Dendrobium catenatum] ref|XP_020695066.1| pentatricopeptide repeat-containing protein At5g57250, mitochondrial [Dendrobium catenatum] ref|XP_020695067.1| pentatricopeptide repeat-containing protein At5g57250, mitochondrial [Dendrobium catenatum] ref|XP_020695068.1| pentatricopeptide repeat-containing protein At5g57250, mitochondrial [Dendrobium catenatum] ref|XP_020695069.1| pentatricopeptide repeat-containing protein At5g57250, mitochondrial [Dendrobium catenatum] ref|XP_020695070.1| pentatricopeptide repeat-containing protein At5g57250, mitochondrial [Dendrobium catenatum] Length = 1104 Score = 56.2 bits (134), Expect = 3e-06 Identities = 28/56 (50%), Positives = 39/56 (69%) Frame = -3 Query: 432 HGLFKINSEMDTNVEEYEFLSRESLPCDFDSFYTIIASLCSVGDLQKANSVVTTML 265 HGL +N ++ + EY FL + SL DF++FY+IIA+LCS G+LQKAN +V L Sbjct: 1048 HGLC-MNKTTNSVLNEYNFLCQNSLKYDFETFYSIIATLCSKGELQKANDIVKATL 1102 >ref|XP_020103675.1| pentatricopeptide repeat-containing protein At5g57250, mitochondrial [Ananas comosus] ref|XP_020103676.1| pentatricopeptide repeat-containing protein At5g57250, mitochondrial [Ananas comosus] Length = 1099 Score = 55.1 bits (131), Expect = 8e-06 Identities = 28/48 (58%), Positives = 36/48 (75%) Frame = -3 Query: 399 TNVEEYEFLSRESLPCDFDSFYTIIASLCSVGDLQKANSVVTTMLMTS 256 +N+EE L +SL DFDS+Y IIASLCS G+L+KAN+VV ML+ S Sbjct: 1051 SNMEECNDLMGKSLHDDFDSYYPIIASLCSKGELKKANNVVKAMLLNS 1098